DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and rbm14b

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:184 Identity:73/184 - (39%)
Similarity:105/184 - (57%) Gaps:14/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TFKLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAI 70
            |.|||:|||...|...||.|:||.||.||.|.|::.:.|||::.|.....||:.|||.......:
Zfish     6 TVKLFVGNLALDTTQEELSAIFESYGQVVSCSVLRQFAFVHLQGEGAAERAIRELNGREFKGRNL 70

  Fly    71 KVEAAKSRRAPNTP--TTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQ 133
            .||.::.|     |  :||:|||||:......:::||||.:|.|:|||.|:.|.|||::...|..
Zfish    71 VVEESRGR-----PLHSTKVFVGNLSSMCTTEDLQELFQTFGKVLECDKVKGYAFVHMENKEDAL 130

  Fly   134 DAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE---QCYRCGRSGHWSKECP 184
            .||:.|:|....|:||.|::|    :.:|....|.   .|..||:.||::.|||
Zfish   131 QAIEALHGTSFKGRPLSVELS----KVQPSKQTPTGKIPCVSCGKQGHYAGECP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 27/64 (42%)
RRM1_2_CoAA_like 87..152 CDD:409779 28/64 (44%)
hnRNP-R-Q <88..>258 CDD:273732 39/100 (39%)
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 29/67 (43%)
RRM1_2_CoAA_like 84..149 CDD:240789 28/64 (44%)
AIR1 <150..>187 CDD:331526 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 1 1.000 - - FOG0002310
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1736
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.