DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Srsf7

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001034124.2 Gene:Srsf7 / 362687 RGDID:1307425 Length:238 Species:Rattus norvegicus


Alignment Length:273 Identity:77/273 - (28%)
Similarity:106/273 - (38%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN---YGFVHLDCVGDVQDAIKELNGRVVDGQ 147
            ||::||||.......|:...|..||.:....|.||   :.||..:...|.:||::.|:|:|:.|.
  Rat    11 TKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGS 75

  Fly   148 PLKVQVSTSRVR-------PKPGMGDP-EQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGG 204
            .::|::||...|       |.....|| ::||.||..||::.:|.| |......|......|.. 
  Rat    76 RVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHR-YSRRRRSRSRSRSHSRS- 138

  Fly   205 YRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRDFPPPPISR 269
             |.|.|.|.            |.|            .|...||....||.::..:|        |
  Rat   139 -RGRRYSRS------------RSR------------SRGRRSRSASPRRSRSVSLR--------R 170

  Fly   270 REPMPLPPTLSGSL--------------RSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSPTPHG 320
            .....|..:.|||:              ||.|:||...:....|||.|.|     ||..|.:|| 
  Rat   171 SRSASLRRSRSGSIIGSRYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKR-----SRSPSGSPH- 229

  Fly   321 YEDFSRDAFDERM 333
                 |.|..|||
  Rat   230 -----RSASPERM 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/67 (31%)
hnRNP-R-Q <88..>258 CDD:273732 49/180 (27%)
Srsf7NP_001034124.2 RRM_SRSF7 12..88 CDD:410050 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.