Sequence 1: | NP_523957.1 | Gene: | lark / 38811 | FlyBaseID: | FBgn0011640 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957161.1 | Gene: | srsf5a / 335396 | ZFINID: | ZDB-GENE-030131-7336 | Length: | 259 | Species: | Danio rerio |
Alignment Length: | 239 | Identity: | 56/239 - (23%) |
---|---|---|---|
Similarity: | 96/239 - (40%) | Gaps: | 47/239 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKV 72
Fly 73 EAAKSRRA------------------------------PNTPTTKIFVGNLTDKTRAPEVRELFQ 107
Fly 108 KYGTVVECDIVR---NYGFVHLDCVGDVQDAIKELNGRVVDGQPLKV--------------QVST 155
Fly 156 SRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSP 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lark | NP_523957.1 | RRM1_2_CoAA_like | 8..73 | CDD:409779 | 17/64 (27%) |
RRM1_2_CoAA_like | 87..152 | CDD:409779 | 21/81 (26%) | ||
hnRNP-R-Q | <88..>258 | CDD:273732 | 33/129 (26%) | ||
srsf5a | NP_957161.1 | RRM1_SRSF4_like | 5..72 | CDD:240783 | 18/66 (27%) |
RRM2_SRSF4_like | 113..184 | CDD:241044 | 21/70 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |