DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and srsf5a

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_957161.1 Gene:srsf5a / 335396 ZFINID:ZDB-GENE-030131-7336 Length:259 Species:Danio rerio


Alignment Length:239 Identity:56/239 - (23%)
Similarity:96/239 - (40%) Gaps:47/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKV 72
            ::|||.|....:..::...|:.||.:.|.::...:|||..:..:...||:..|||..|....:.:
Zfish     5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDYRDADDAVYELNGKELCSERVTI 69

  Fly    73 EAAKSRRA------------------------------PNTPTTKIFVGNLTDKTRAPEVRELFQ 107
            |.|:|||.                              |.....:|.|.||:.:....::::|.:
Zfish    70 EHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYGPPVRTEHRIIVENLSSRISWQDLKDLMR 134

  Fly   108 KYGTVVECDIVR---NYGFVHLDCVGDVQDAIKELNGRVVDGQPLKV--------------QVST 155
            |.|.|...|..|   |.|.|......|:::||::|:|..::|:.||:              ..|:
Zfish   135 KVGEVTFVDAHRTKKNEGVVEFASHSDMKNAIEKLDGTDLNGRKLKLYEDRKRNRSRSRSRSRSS 199

  Fly   156 SRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSP 199
            ||.|.......||:..:..||...|:...:...|.......|:|
Zfish   200 SRSRSPSRSRSPERGSKRSRSRSLSRTPEKKSTSNRSPSRSPTP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 17/64 (27%)
RRM1_2_CoAA_like 87..152 CDD:409779 21/81 (26%)
hnRNP-R-Q <88..>258 CDD:273732 33/129 (26%)
srsf5aNP_957161.1 RRM1_SRSF4_like 5..72 CDD:240783 18/66 (27%)
RRM2_SRSF4_like 113..184 CDD:241044 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.