Sequence 1: | NP_523957.1 | Gene: | lark / 38811 | FlyBaseID: | FBgn0011640 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001103597.1 | Gene: | rbm38 / 333991 | ZFINID: | ZDB-GENE-030131-5923 | Length: | 234 | Species: | Danio rerio |
Alignment Length: | 236 | Identity: | 53/236 - (22%) |
---|---|---|---|
Similarity: | 74/236 - (31%) | Gaps: | 86/236 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 NTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV--------RNYGFVHLDCVGDVQDAIKE 138
Fly 139 LNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAG 203
Fly 204 GYR-----------DRMYGRDP---YPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRY 254
Fly 255 QTSRMRDFP------------PP-------PISRREPMPLP 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lark | NP_523957.1 | RRM1_2_CoAA_like | 8..73 | CDD:409779 | |
RRM1_2_CoAA_like | 87..152 | CDD:409779 | 21/72 (29%) | ||
hnRNP-R-Q | <88..>258 | CDD:273732 | 40/191 (21%) | ||
rbm38 | NP_001103597.1 | RRM_RBM24_RBM38_like | 25..100 | CDD:240830 | 23/111 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |