DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and ssx

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:236 Identity:60/236 - (25%)
Similarity:99/236 - (41%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQNLNGYTL 65
            |.|..|.:.....||..||...|.:..|.::::        ||||..:||....||||.|||:.:
  Fly    95 LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYV 159

  Fly    66 NEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YG 122
            ....:||..|:. ...:...|.::|.||:.......:..:|..||.:|:.:|:|:        ..
  Fly   160 RNKRLKVSYARP-GG
QSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVA 223

  Fly   123 FVHLDCVGDVQDAIKELNGRVVDG--QPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPR 185
            ||..:...:.|:|||.||..|.:|  ||:.|:::....:.|...      :.....|        
  Fly   224 FVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQ------FMAQIGG-------- 274

  Fly   186 LYGSAGGGREPP-----SPLSAGGYRDRMYGRDPYPPPPPP 221
              |:.|||..||     .|:....:.:..:..:.:.|..||
  Fly   275 --GNGGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 23/71 (32%)
RRM1_2_CoAA_like 87..152 CDD:409779 21/74 (28%)
hnRNP-R-Q <88..>258 CDD:273732 34/149 (23%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 25/78 (32%)
RRM_SF 179..257 CDD:302621 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.