DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and TRA2A

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:200 Identity:62/200 - (31%)
Similarity:87/200 - (43%) Gaps:46/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV--------RNYGFVHLDCVGDVQDA 135
            ||...|.|.:.|..|:..|...::||:|.:||.:...::|        |.:.||:.:.:.|.::|
Human   112 RANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEA 176

  Fly   136 IKELNGRVVDGQPLKVQVS-TSRVR-PKPG--MGDPEQCYRCGRSGHWSKECPRLYGSAGGGREP 196
            ::..||..:||:.::|..| |.|.. |.||  ||.|......|..|...       |..||||..
Human   177 MERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGG-------GGGGGGRRR 234

  Fly   197 PSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDY-YDRRFEDSRDLYERRYQT-SRM 259
            .|      |.||.|                ||..|.:.|||| |.||   |...|..||:: ||.
Human   235 DS------YYDRGY----------------DRGYDRYEDYDYRYRRR---SPSPYYSRYRSRSRS 274

  Fly   260 RDFPP 264
            |.:.|
Human   275 RSYSP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 18/72 (25%)
hnRNP-R-Q <88..>258 CDD:273732 54/183 (30%)
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 2/5 (40%)
RRM_TRA2 118..197 CDD:409798 21/78 (27%)
Linker 198..225 9/26 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 19/72 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.