DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Pabpc4

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006238860.1 Gene:Pabpc4 / 298510 RGDID:1305015 Length:660 Species:Rattus norvegicus


Alignment Length:175 Identity:49/175 - (28%)
Similarity:85/175 - (48%) Gaps:20/175 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVV------KNYGFVHMETEQQGRDAIQNLNG 62
            :|...:||.|||:......|...|..:|.::.|.||      |.|.|||.||::....||:.:||
  Rat    96 SGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAANKAIEKMNG 160

  Fly    63 YTLNEFAIKVEAAKSRR-------APNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN 120
            ..||:..:.|...|||:       |.....|.:::.|..::.....:||||.::|..:...::|:
  Rat   161 MLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDENLRELFSQFGKTLSVKVMRD 225

  Fly   121 -------YGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRV 158
                   :|||..:...|...|::|:||:.:.|:.:.|..:..:|
  Rat   226 CSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKSIFVGRAQKKV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 24/70 (34%)
RRM1_2_CoAA_like 87..152 CDD:409779 16/71 (23%)
hnRNP-R-Q <88..>258 CDD:273732 18/78 (23%)
Pabpc4XP_006238860.1 PABP-1234 11..640 CDD:130689 49/175 (28%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825 26/74 (35%)
RRM3_I_PABPs 190..269 CDD:240826 18/78 (23%)
RRM4_I_PABPs 293..370 CDD:240827
PABP 572..639 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.