DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Pabpc1l

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038962521.1 Gene:Pabpc1l / 296351 RGDID:1563142 Length:669 Species:Rattus norvegicus


Alignment Length:173 Identity:50/173 - (28%)
Similarity:81/173 - (46%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PG---AGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVVKN------YGFVHMETEQQGRDAI 57
            ||   :|...:||.||:.......|...|..:|:::...||.|      :||||.||.:..:.||
  Rat    91 PGLRRSGMGNIFIKNLENSIDNKALYDTFSTFGSILSSKVVYNEHGSRGFGFVHFETHEAAQKAI 155

  Fly    58 QNLNGYTLNEFAIKVEAAKSRR-------APNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVEC 115
            ..:||..||:..:.|...|||:       |.....|.|:|.||........:::||.::|.....
  Rat   156 NTMNGMLLNDRKVFVGHFKSRQKREAELGARALGFTNIYVKNLRVDMDEQGLQDLFSQFGKTQSV 220

  Fly   116 DIVRN-------YGFVHLDCVGDVQDAIKELNGRVVDGQPLKV 151
            .::|:       :||::.:...:.|.|:..:||:.|.||.|.|
  Rat   221 KVMRDSNGQSRGFGFINFEKHEEAQKAVDHMNGKEVSGQLLYV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 22/70 (31%)
RRM1_2_CoAA_like 87..152 CDD:409779 19/72 (26%)
hnRNP-R-Q <88..>258 CDD:273732 19/71 (27%)
Pabpc1lXP_038962521.1 PABP-1234 11..656 CDD:130689 50/173 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.