DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Srsf9

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038945194.1 Gene:Srsf9 / 288701 RGDID:1309495 Length:247 Species:Rattus norvegicus


Alignment Length:269 Identity:69/269 - (25%)
Similarity:97/269 - (36%) Gaps:79/269 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCV--GDVQDAIKELNGRVVDGQ-- 147
            :|:||||....|..::.:||.|||.:.|.::...:|.|....|  .|.:..::.|.||....|  
  Rat    15 RIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRHGLRALTGRNSKSQRS 79

  Fly   148 -----PLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKEC------PRLYGSAGG----GREPP 197
                 ||.|.             |.|... .||:|:...:|      ||.||..||    .|..|
  Rat    80 AFLWLPLLVT-------------DAEDAI-YGRNGYDYGQCRLRVEFPRAYGGRGGWPRASRNGP 130

  Fly   198 SPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRI------------MDGF--------RDYDYYDRR 242
             |.....:|..:.|.    ||......|:|.:            .||.        .|.:|..|:
  Rat   131 -PTRRSDFRVLVSGL----PPSGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRK 190

  Fly   243 FEDSRDLYERRYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSS 307
            .:|:: ......:||.:|.:|.           ..|..|..||.|.|||.|:         |..|
  Rat   191 LDDTK-FRSHEGETSYIRVYPE-----------RGTSYGCSRSRSGSRGRDS---------PYQS 234

  Fly   308 NGMSRYGSP 316
            .|...|.||
  Rat   235 RGSPHYFSP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 22/73 (30%)
hnRNP-R-Q <88..>258 CDD:273732 51/208 (25%)
Srsf9XP_038945194.1 RRM1_SRSF9 15..112 CDD:241042 29/110 (26%)
RRM2_SRSF9 129..212 CDD:410161 18/99 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.