DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RBMS3

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001003793.1 Gene:RBMS3 / 27303 HGNCID:13427 Length:437 Species:Homo sapiens


Alignment Length:262 Identity:53/262 - (20%)
Similarity:91/262 - (34%) Gaps:82/262 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVECDVV--------KNYGFVHMETEQQGRDAIQNL--NGY 63
            |:|..|...|...:|..|.:.||.:|....:        |.||||..::....:.|:.:|  || 
Human    63 LYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASLKANG- 126

  Fly    64 TLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN-------Y 121
                    |:|..:::....| |.:::.||.......|:..:.:.:|.|:...|:|:       .
Human   127 --------VQAQMAKQQE
QDP-TNLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSRGV 182

  Fly   122 GFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRC------------- 173
            ||..::.....:..|:..||:.              ::..||:..|.:...|             
Human   183 GFARMESTEKCEVVIQHFNGKY--------------LKTPPGIPAPSEPLLCKFADGGQKKRQNQ 233

  Fly   174 ------GRSGHWSKECPRLYGSAGGG--REPPSPLSAGGYRDRMYGRDPYP-------PPPPPPP 223
                  ||.  |.:|     |.||..  .:|.:.:..|.|      ..||.       |.....|
Human   234 SKYTQNGRP--WPRE-----GEAGMALTYDPTAAIQNGFY------SSPYSIATNRMIPQTSITP 285

  Fly   224 FL 225
            |:
Human   286 FI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 18/73 (25%)
RRM1_2_CoAA_like 87..152 CDD:409779 12/71 (17%)
hnRNP-R-Q <88..>258 CDD:273732 31/173 (18%)
RBMS3NP_001003793.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..57
RRM1_RBMS3 57..136 CDD:409902 20/81 (25%)
RRM2_RBMS3 139..226 CDD:240919 18/101 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.