Sequence 1: | NP_523957.1 | Gene: | lark / 38811 | FlyBaseID: | FBgn0011640 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055829.2 | Gene: | RBM34 / 23029 | HGNCID: | 28965 | Length: | 430 | Species: | Homo sapiens |
Alignment Length: | 218 | Identity: | 46/218 - (21%) |
---|---|---|---|
Similarity: | 81/218 - (37%) | Gaps: | 57/218 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 LFIGNLDEKTQATELRALFEKYGTV-------------------------VECDVVKNYGFVHME 48
Fly 49 TEQQGRDAIQNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVV 113
Fly 114 ECDIVRN--------YGFVHLDCVGDVQDAIK----ELNG------RVVDGQPLKVQVSTSRV-- 158
Fly 159 --RPKPGM--------GDPEQCY 171 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lark | NP_523957.1 | RRM1_2_CoAA_like | 8..73 | CDD:409779 | 14/88 (16%) |
RRM1_2_CoAA_like | 87..152 | CDD:409779 | 22/82 (27%) | ||
hnRNP-R-Q | <88..>258 | CDD:273732 | 30/114 (26%) | ||
RBM34 | NP_055829.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..55 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 72..123 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 134..153 | ||||
RRM | 176..>382 | CDD:223796 | 41/196 (21%) | ||
RRM1_RBM34 | 185..276 | CDD:240840 | 14/88 (16%) | ||
RRM2_RBM34 | 288..360 | CDD:240841 | 19/71 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 365..395 | 7/29 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 411..430 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |