DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RBM34

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:218 Identity:46/218 - (21%)
Similarity:81/218 - (37%) Gaps:57/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTV-------------------------VECDVVKNYGFVHME 48
            :|:|||.......:|::.|::||.:                         :..|......:|..:
Human   187 VFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSLIPAEGTLSKKLAAIKRKIHPDQKNINAYVVFK 251

  Fly    49 TEQQGRDAIQNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVV 113
            .|.....|::.......:.|.|:|:.|.  ...:.....:|||||..|.....:.:.|...|:::
Human   252 EESAATQALKRNGAQIADGFRIRVDLAS--ETSSRDKRSVFVGNLPYKVEESAIEKHFLDCGSIM 314

  Fly   114 ECDIVRN--------YGFVHLDCVGDVQDAIK----ELNG------RVVDGQPLKVQVSTSRV-- 158
            ...|||:        :|:|..:....|..|:|    ||.|      |.|:.:..|.|.|..|:  
Human   315 AVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNNSELMGRKLRVMRSVNKEKFKQQNSNPRLKN 379

  Fly   159 --RPKPGM--------GDPEQCY 171
              :||.|:        |.|:..:
Human   380 VSKPKQGLNFTSKTAEGHPKSLF 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 14/88 (16%)
RRM1_2_CoAA_like 87..152 CDD:409779 22/82 (27%)
hnRNP-R-Q <88..>258 CDD:273732 30/114 (26%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153
RRM 176..>382 CDD:223796 41/196 (21%)
RRM1_RBM34 185..276 CDD:240840 14/88 (16%)
RRM2_RBM34 288..360 CDD:240841 19/71 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.