DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Srsf5

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001334344.1 Gene:Srsf5 / 20384 MGIID:98287 Length:270 Species:Mus musculus


Alignment Length:259 Identity:61/259 - (23%)
Similarity:106/259 - (40%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKV 72
            ::|||.|:...:..::...|:.||.:.:.|:.:.:|||..|..:...||:..|:|..|....:.:
Mouse     5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTI 69

  Fly    73 EAAKSR----------------RAP-----NTP----TTKIFVGNLTDKTRAPEVRELFQKYGTV 112
            |.|::|                |.|     |.|    ..::.|.||:.:....::::..::.|.|
Mouse    70 EHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEV 134

  Fly   113 VECDIVR---NYGFVHLDCVGDVQDAIKELNGRVVDGQPLKV---------QVSTSRVRPKPGMG 165
            ...|..|   |.|.|.....||:::||::|:|:.::|:.:|:         ..|.||.|.:....
Mouse   135 TFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSR 199

  Fly   166 DPEQCYRCGRSGHWSKECPRLYG---SAGGGREP--------------PSPLSAGGYRDRMYGR 212
            ...:. |..||..:|:...|...   |..|.|.|              .||.|....|.|...|
Mouse   200 SRSRS-RSRRSKSYSRSRSRSRSRSKSRSGSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 17/64 (27%)
RRM1_2_CoAA_like 87..152 CDD:409779 18/76 (24%)
hnRNP-R-Q <88..>258 CDD:273732 37/154 (24%)
Srsf5NP_001334344.1 RRM1_SRSF5 5..74 CDD:410008 19/68 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..105 5/31 (16%)
RRM2_SRSF5 99..179 CDD:410158 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.