DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Srsf3

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_038691.1 Gene:Srsf3 / 20383 MGIID:98285 Length:164 Species:Mus musculus


Alignment Length:183 Identity:49/183 - (26%)
Similarity:68/183 - (37%) Gaps:55/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN---YGFVHLDCVGDVQDAIKELNGRVVDGQP 148
            |::||||.:.....|:...|..||.:....:.||   :.||..:...|..||::||:||.:.|..
Mouse    11 KVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCR 75

  Fly   149 LKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRD 213
            ::|::|....|.: ..|.|..         |             ||.|               ||
Mouse    76 VRVELSNGEKRSR-NRGPPPS---------W-------------GRRP---------------RD 102

  Fly   214 PYPPPPPPP--------PFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSR 258
            .|....|||        .|.|.|.....|     |||.|.|.. .||.::.||
Mouse   103 DYRRRSPPPRRRSPRRRSFSRSRSRSLSR-----DRRRERSLS-RERNHKPSR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/67 (31%)
hnRNP-R-Q <88..>258 CDD:273732 46/180 (26%)
Srsf3NP_038691.1 Sufficient for interaction with NXF1 and SRSP. /evidence=ECO:0000250|UniProtKB:P84103 1..90 24/79 (30%)
RRM_SRSF3 6..86 CDD:241089 23/74 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 27/113 (24%)
2 X approximate repeats, basic 119..164 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.