DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Rnps1

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_033096.2 Gene:Rnps1 / 19826 MGIID:97960 Length:305 Species:Mus musculus


Alignment Length:255 Identity:55/255 - (21%)
Similarity:80/255 - (31%) Gaps:112/255 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECD---------IVRNYGFVHLDC 128
            |..:.||:|:...||:.:|.||.......:.|:|..||.:...|         :.:.|.:|..:.
Mouse   148 EKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFEN 212

  Fly   129 VGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGG 193
            ..:.:.|:|.::|..:|||    :::.:.|..                                 
Mouse   213 PDEAEKALKHMDGGQIDGQ----EITATAVLA--------------------------------- 240

  Fly   194 REPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSR 258
                                |:|.|||                    |||...|           
Mouse   241 --------------------PWPRPPP--------------------RRFSPPR----------- 254

  Fly   259 MRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPP------PRSSNGMSR 312
             |..||||:.||.| |.....|.|.|..|..|       |||..|      .|||:..||
Mouse   255 -RMLPPPPMWRRSP-PRMRRRSRSPRRRSPVR-------RRSRSPGRRRHRSRSSSNSSR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 55/255 (22%)
RRM1_2_CoAA_like 87..152 CDD:409779 17/73 (23%)
hnRNP-R-Q <88..>258 CDD:273732 26/178 (15%)
Rnps1NP_033096.2 Necessary for interaction with the cleaved p110 isoform of CDC2L1. /evidence=ECO:0000250 1..220 16/71 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..170 8/21 (38%)
Necessary for interaction with SRP54, nuclear localization and exon-skipping. /evidence=ECO:0000250 1..161 4/12 (33%)
Necessary for interactions with UPF2 and UPF3B and UPF2-dependent NMD. /evidence=ECO:0000250 69..121
Necessary for interaction with PNN and exon-skipping. /evidence=ECO:0000250 156..242 20/142 (14%)
Interaction with SAP18 and ACIN1. /evidence=ECO:0000250 159..244 20/141 (14%)
RRM_RNPS1 163..236 CDD:409800 16/76 (21%)
Necessary for interaction with TRA2B, nuclear localization and exon-skipping. /evidence=ECO:0000250 238..305 31/159 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..305 30/157 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.