DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and rnp-1

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001256408.1 Gene:rnp-1 / 179672 WormBaseID:WBGene00004384 Length:305 Species:Caenorhabditis elegans


Alignment Length:314 Identity:84/314 - (26%)
Similarity:134/314 - (42%) Gaps:61/314 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLK 150
            :|:|||||.|...:.:::::||.:..|.|||||:||.|||:: ..||...|..|.|..:||:.:.
 Worm     3 SKLFVGNLPDNVDSNKLKQVFQPFCKVTECDIVKNYAFVHIE-EDDVDPIITRLTGYTIDGKVVN 66

  Fly   151 VQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPR------------------LYGSAGGGREPP 197
            ::.|||::||.|||  |.:|:||....|.:.:||:                  |...||..|...
 Worm    67 IKKSTSKLRPTPGM--PNRCFRCQSDEHRTPQCPQDPTNNQKTENGVQTLKFDLTSGAGVKRSAG 129

  Fly   198 SPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRD--LYERR------- 253
            .|:.....| ..||......|..|.|...| :...:::|....:|:...||  |.|..       
 Worm   130 DPIIDSAKR-IAYGAQSVVEPEIPQPMDPD-LQALYQEYQLSRQRYVYYRDRLLKEMEAKQHGST 192

  Fly   254 --YQTSRMRDFP------PPPISRREPMPL------PPTLSGSLRSCSVSRGYDTMFSRRSP--- 301
              :..|.....|      ||..::....|:      ||.::      |::..|....:.|:|   
 Worm   193 AGFALSSSSTVPVPVASAPPGATQLSAAPVSYQPNAPPVIA------SINAPYAVASNLRAPYAL 251

  Fly   302 -PPPRSSNGMSRYGSPTPHGYED--FSRDAFDERMISSRGMRGPSP---PGRRY 349
             ..|.:|...:.|||.||.|...  .:...:.:::...:....|:|   |.|.|
 Worm   252 QSAPYASAASAPYGSVTPAGAPSNVMTTQQYLQQIQHQQATGSPAPVPAPPRLY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 27/64 (42%)
hnRNP-R-Q <88..>258 CDD:273732 59/198 (30%)
rnp-1NP_001256408.1 RRM <2..>83 CDD:223796 36/82 (44%)
RRM1_2_CoAA_like 4..68 CDD:240789 27/64 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I7240
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3634
Isobase 1 0.950 - 0 Normalized mean entropy S3124
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002310
OrthoInspector 1 1.000 - - oto20074
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4630
SonicParanoid 1 1.000 - - X1736
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.