DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and aly-2

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_501594.1 Gene:aly-2 / 177738 WormBaseID:WBGene00000121 Length:227 Species:Caenorhabditis elegans


Alignment Length:99 Identity:24/99 - (24%)
Similarity:43/99 - (43%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGT-VVECDIVRNYGFVHLDCVGDV----QDA---IKELNGRV 143
            :|.:.||.:...:.:::|||..:.. .|..:...|.|...   .||:    .||   |::..|..
 Worm    81 RINISNLAETVISSDLQELFGAFNLHKVSVNFNENGGAAG---TGDITLKKYDADRLIQKFAGVA 142

  Fly   144 VDGQPLKVQV-STSRVRPKPGM-GDPEQCYRCGR 175
            :||:.:...| .:|....||.: |.|.:....|:
 Worm   143 LDGKVMHFAVIESSNFARKPEIRGTPNRRQSSGK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 17/72 (24%)
hnRNP-R-Q <88..>258 CDD:273732 24/98 (24%)
aly-2NP_501594.1 RRM_SF 80..152 CDD:473069 17/73 (23%)
FoP_duplication 165..>227 CDD:464005 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.