Sequence 1: | NP_523957.1 | Gene: | lark / 38811 | FlyBaseID: | FBgn0011640 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496442.1 | Gene: | rsp-1 / 174748 | WormBaseID: | WBGene00004698 | Length: | 312 | Species: | Caenorhabditis elegans |
Alignment Length: | 322 | Identity: | 77/322 - (23%) |
---|---|---|---|
Similarity: | 101/322 - (31%) | Gaps: | 121/322 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKV 151
Fly 152 QVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRDPYP 216
Fly 217 PPPP-------PPPFLRDRIM-------------------------------------------- 230
Fly 231 ---------DGF----RDYDYYD------------------RRFEDSRDLYERRYQTSRMRDFPP 264
Fly 265 PPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSR----------RSPPPPRSSNGMSRYGSP 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lark | NP_523957.1 | RRM1_2_CoAA_like | 8..73 | CDD:409779 | |
RRM1_2_CoAA_like | 87..152 | CDD:409779 | 18/64 (28%) | ||
hnRNP-R-Q | <88..>258 | CDD:273732 | 50/251 (20%) | ||
rsp-1 | NP_496442.1 | RRM | <3..180 | CDD:223796 | 42/197 (21%) |
RRM1_SRSF4_like | 4..73 | CDD:240783 | 19/72 (26%) | ||
RRM2_SRSF4_like | 129..200 | CDD:241044 | 4/70 (6%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |