DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and rsp-2

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_496441.1 Gene:rsp-2 / 174747 WormBaseID:WBGene00004699 Length:281 Species:Caenorhabditis elegans


Alignment Length:324 Identity:73/324 - (22%)
Similarity:104/324 - (32%) Gaps:120/324 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKV 151
            ::::|.|.::....:|...|:.||.:.:..:...:|||......|..||:.:|||:.:.|:.:.:
 Worm     3 RVYIGRLPNRASDRDVEHFFRGYGKLSDVIMKNGFGFVDFQDQRDADDAVHDLNGKELCGERVIL 67

  Fly   152 QVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYR--DRMYGRDP 214
            :.      |:..:|..|:     ||           ||...||||  ....||.|  ...|.|  
 Worm    68 EF------PRRKVGYNEE-----RS-----------GSGFRGREP--TFRKGGERQFSNRYSR-- 106

  Fly   215 YPPPPPPPPF---------------LRDRIM--------------------------DGFRD--- 235
                |....|               ::|.|.                          |..||   
 Worm   107 ----PCSTRFRLVIDNLSTRYSWQDIKDHIRKLGIEPTYSEAHKRNVNQAIVCFTSHDDLRDAMN 167

  Fly   236 ----YDYYDRRF---EDSRDLYERRYQTSRMRDFPP-----PPISRREPMPLPPTLSGSLRSCSV 288
                .|...|:.   :::||....|....|.|...|     ||..||.|        ||.||...
 Worm   168 KLQGEDLNGRKLKCTDETRDRSRSRSPRRRSRSRSPTRSRSPPARRRSP--------GSDRSDRK 224

  Fly   289 SRGYDTMFSRRSPPPPRS-SNGMSRYGSPTPHGYEDFSRDAFDERMISSRGMRGPSPPGRRYAP 351
            ||....  .:||....|| |...||.|                     .|..|..|||.|..:|
 Worm   225 SRSASP--KKRSDKRARSESKSRSRSG---------------------GRRSRSNSPPNRSPSP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 16/64 (25%)
hnRNP-R-Q <88..>258 CDD:273732 44/222 (20%)
rsp-2NP_496441.1 RRM_SF 112..184 CDD:302621 8/71 (11%)
RRM1_SRSF4_like 3..71 CDD:240783 16/73 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.