DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Elavl4

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006502856.1 Gene:Elavl4 / 15572 MGIID:107427 Length:397 Species:Mus musculus


Alignment Length:256 Identity:68/256 - (26%)
Similarity:100/256 - (39%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GAGT----FKLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRD 55
            ||.|    ..|.:..|.:.....|.|:||...|.:..|.:|::        ||||:....:....
Mouse    55 GAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEK 119

  Fly    56 AIQNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV-- 118
            ||..|||..|....|||..|:...| :.....::|..|.......|:.:||.:||.::...|:  
Mouse   120 AINTLNGLRLQTKTIKVSYARPSSA-SIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVD 183

  Fly   119 ------RNYGFVHLDCVGDVQDAIKELNGRVVDG--QPLKVQVSTSRVRPKPGMGDPEQCYRCGR 175
                  |..||:..|...:.::|||.|||:...|  :|:.|:.:          .:|.|     :
Mouse   184 QVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA----------NNPSQ-----K 233

  Fly   176 SGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRM-------YG-----RDPYPPPPPPPPF 224
            |.  .....:||.|.  .|..|.||.....|.|:       ||     ..|.||...||.|
Mouse   234 SS--QALLSQLYQSP--NRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 21/72 (29%)
RRM1_2_CoAA_like 87..152 CDD:409779 20/74 (27%)
hnRNP-R-Q <88..>258 CDD:273732 41/159 (26%)
Elavl4XP_006502856.1 ELAV_HUD_SF 60..396 CDD:273741 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.