DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and SRSF8

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_115285.1 Gene:SRSF8 / 10929 HGNCID:16988 Length:282 Species:Homo sapiens


Alignment Length:257 Identity:74/257 - (28%)
Similarity:98/257 - (38%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VGNLTDKTRAPEVRELFQKYGTVVECDI--------VRNYGFVHLDCVGDVQDAIKELNGRVVDG 146
            |.|||.:|....:|.:|:|||.|.:..|        .|.:.||......|.|||...::|..:||
Human    18 VDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDG 82

  Fly   147 QPLKVQVST--SRVRPKPGMGDPEQCYRCG------RS-GHWSKECPRLYGSAGGGREPPSPLSA 202
            :.|:|||:.  .|..|:...|:|....|.|      || |..|:...|.:.|...|.......|.
Human    83 RELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHRSRSRGPSCSRSRSR 147

  Fly   203 GGYRDRMYGRDPYPPPP------PPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYER--RYQTSRM 259
            ..||...|.|.||...|      ...|:.|.|    :|:..|....:..|.....|  ||.:||.
Human   148 SRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSR----YRESRYGGSHYSSSGYSNSRYSRYHSSRS 208

  Fly   260 RDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFS---RRSPPPPRSSNGMSRYGSPTP 318
            ........|.|.......:.:...:|.||||......|   .||||........||..|..|
Human   209 HSKSGSSTSSRSASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 23/69 (33%)
hnRNP-R-Q <88..>258 CDD:273732 56/192 (29%)
SRSF8NP_115285.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 23/69 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..282 48/184 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.