DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and SRSF10

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_473357.1 Gene:SRSF10 / 10772 HGNCID:16713 Length:262 Species:Homo sapiens


Alignment Length:283 Identity:69/283 - (24%)
Similarity:100/283 - (35%) Gaps:84/283 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDI--------VRNYGFVHLDCVGDVQDAIKELN 140
            |.|.:||.|:.|.||:.::|..|.:||.:|:..:        .|.:.:|..:.|.|.:||:..|:
Human     8 PNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLD 72

  Fly   141 GRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGY 205
            .:.:.|:.:::|.                                    |.|.|:.|:.:.|   
Human    73 RKWICGRQIEIQF------------------------------------AQGDRKTPNQMKA--- 98

  Fly   206 RDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRDFPPPPISRR 270
               ..||:.|.             ...:.|||.|.|....|   ||||...||..|:.    .||
Human    99 ---KEGRNVYS-------------SSRYDDYDRYRRSRSRS---YERRRSRSRSFDYN----YRR 140

  Fly   271 EPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRS-SNGMSRYGSPTPHGYEDFSRDAFDERMI 334
            ...|.....:|..|. |.|...:..|..|:....|| ||..||..|......:..||    .|..
Human   141 SYSPRNSRPTGRPRR-SRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSR----SRSA 200

  Fly   335 SSRGMRGPS--------PPGRRY 349
            |....||.|        ..|.||
Human   201 SHTKTRGTSKTDSKTHYKSGSRY 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 19/72 (26%)
hnRNP-R-Q <88..>258 CDD:273732 38/177 (21%)
SRSF10NP_473357.1 RRM_SF 5..99 CDD:473069 27/132 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262 36/120 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.