powered by:
Protein Alignment lark and srsf3b
DIOPT Version :9
Sequence 1: | NP_523957.1 |
Gene: | lark / 38811 |
FlyBaseID: | FBgn0011640 |
Length: | 352 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021324965.1 |
Gene: | srsf3b / 100145909 |
ZFINID: | ZDB-GENE-071005-2 |
Length: | 358 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 28/74 - (37%) |
Gaps: | 5/74 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 TLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDC 128
:||...:|:......|.| .:|.|:.|||....|..:|...|..........:|..:....
Zfish 123 SLNLTGVKLVMQSEVREP-----PVFRGDGTDKFTVHEWEDLLDTYLRKRGIPASEHYHEILSRL 182
Fly 129 VGDVQDAIK 137
:|..:|.:|
Zfish 183 LGKAKDIVK 191
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.