DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and srsf3b

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_958480.2 Gene:srsf3b / 100145909 ZFINID:ZDB-GENE-071005-2 Length:164 Species:Danio rerio


Alignment Length:243 Identity:57/243 - (23%)
Similarity:76/243 - (31%) Gaps:102/243 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN---YGFVHLDCVGDVQDAIKELNGRVVDGQP 148
            |::||||.:.....|:...|..||.:....:.||   :.||..:...|..||::||:||.:.|..
Zfish    10 KVYVGNLGNNGNKSELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDATDAVRELDGRTLCGCR 74

  Fly   149 LKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRD 213
            ::|:                                               ||.|..|.|..|  
Zfish    75 VRVE-----------------------------------------------LSNGEKRTRSRG-- 90

  Fly   214 PYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRDFPPPPISRREPMPLPPT 278
                  |||.               ::||   .||.|.||         ..||..||.|      
Zfish    91 ------PPPS---------------WNRR---PRDDYRRR---------SSPPQRRRSP------ 116

  Fly   279 LSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSPTPHGYEDFSR 326
                 |..|.||.....|||..    |....:||..:..|.  ..|||
Zfish   117 -----RRRSFSRSRSRSFSRER----RRERSLSRERNHKPS--RSFSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/67 (31%)
hnRNP-R-Q <88..>258 CDD:273732 37/172 (22%)
srsf3bNP_958480.2 RRM_SRSF3 5..85 CDD:241089 25/121 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.