DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrva and ATR1

DIOPT Version :9

Sequence 1:NP_001261505.1 Gene:mrva / 38808 FlyBaseID:FBgn0035763 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:46/203 - (22%)
Similarity:85/203 - (41%) Gaps:38/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RFMALVFMCL-LGFGSY--FCYDAPGALQNYFKKDLNLTSAQFTLIYSIYSWPNVVLCFVGGFLI 112
            |.|..:.:.| .|:||:  |.:       .||:..||:  .|:|   ::::.....:..:.|.:.
Yeast   332 RHMIQIMLALFFGWGSFGIFTF-------YYFQFQLNI--RQYT---ALWAGGTYFMFLIWGIIA 384

  Fly   113 DRLFGIRLGTIIYMMILLVGQLIFACGGIL-------DAFWMMILGRFI---FGIG----AESLA 163
            ..|.|..:..:...:.|....:.|..|.|:       :.::...||..|   ||:.    |.|:.
Yeast   385 ALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 449

  Fly   164 VAQN---SYAVLWFKGKELNMVFGLQLSVA-RFGSTVNFWVMQPIYEYVSNFYKGHTALGVVLLL 224
            .:.|   .|..:  .|..:|.|....:|:. ..|:||...|... .:::...|:|...||:.  |
Yeast   450 FSDNLPMEYQGM--AGSLVNTVVNYSMSLCLGMGATVETQVNSD-GKHLLKGYRGAQYLGIG--L 509

  Fly   225 ATLTCVMS 232
            |:|.|::|
Yeast   510 ASLACMIS 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrvaNP_001261505.1 MFS 55..448 CDD:119392 44/199 (22%)
MFS_1 58..410 CDD:284993 44/196 (22%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 45/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.