DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mrva and CG18281

DIOPT Version :9

Sequence 1:NP_001261505.1 Gene:mrva / 38808 FlyBaseID:FBgn0035763 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_649236.1 Gene:CG18281 / 40274 FlyBaseID:FBgn0037003 Length:542 Species:Drosophila melanogaster


Alignment Length:253 Identity:54/253 - (21%)
Similarity:85/253 - (33%) Gaps:83/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 KPPFWMVSIICVAYY----VAIFPFIALGQNFFVDRFGLSPAEANTVDSLVY----LIAAVSSPV 326
            |...|...|:...:|    :...|||......|.:|..|       ||.|||    ::..|::||
  Fly    22 KASVWHAVIVTFMHYFSWGLLTVPFIEKLSGSFGNRVLL-------VDGLVYGVRGILGFVTTPV 79

  Fly   327 FGFIIDKLGRNV-------------------TWVFTATLTTIGAHALLTFTQLTPYVG----MII 368
            .|.|.|..||.|                   :|.|.|.| |:.:....|::....||.    :..
  Fly    80 MGAISDFHGRKVVMLLAVATTYAPIPFMMLKSWWFFAIL-TVSSICGSTYSSSLAYVADTTTVEN 143

  Fly   369 MGLSYSMLAASLWPLVALIIPEYQLGTAYGFCQSIQN-----LGLAVITIVAGIIVDHSGGEHMW 428
            ....|.::|||             .|....|..|:.|     .|.|.:.::|.|           
  Fly   144 RSKGYGIVAAS-------------FGAGIAFSPSLGNYLMKSYGSASVILIAAI----------- 184

  Fly   429 LQLFFMGWLTIALISTGVIWAYNNKNRGNL----------NMTPQQRAQFVSAENYQN 476
                 .|.:.|..|...|..:...|.:.|:          ::.|::|.:.::.|...|
  Fly   185 -----TGLINIMFIIFAVPESLVLKEKNNMLDEESDNKMEDINPKERKEILNREEKLN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mrvaNP_001261505.1 MFS 55..448 CDD:119392 48/213 (23%)
MFS_1 58..410 CDD:284993 41/175 (23%)
CG18281NP_649236.1 MFS 25..485 CDD:119392 53/250 (21%)
MFS_1 30..441 CDD:284993 52/245 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.