DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and ARHGEF5

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_005426.2 Gene:ARHGEF5 / 7984 HGNCID:13209 Length:1597 Species:Homo sapiens


Alignment Length:391 Identity:99/391 - (25%)
Similarity:164/391 - (41%) Gaps:91/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QAIQEI----ISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELE 133
            |.:||:    |.||.|||..|.:.::.|......:|.:....|..||.:::.:.:::..||.:||
Human  1173 QKLQEVKFELIVSEASYLRSLNIAVDHFQLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLE 1237

  Fly   134 ANMEN------VAHAFLKMAP-FFKLYSVYAFD--YRGALFIIQDLISKNPVFRKFLEQTESRPE 189
            .|.||      |....|..|| |.::|..|..:  |:...|  |.|::.|..||:.||:.||.|.
Human  1238 ENFENNIFSFQVCDVVLNHAPDFRRVYLPYVTNQTYQERTF--QSLMNSNSNFREVLEKLESDPV 1300

  Fly   190 VQR-KLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASH------INTC- 246
            .|| .|.|.:|:|.||:.|.||||:.:|..|.|.         |.:|.|||.:|      |..| 
Human  1301 CQRLSLKSFLILPFQRITRLKLLLQNILKRTQPG---------SSEEAEATKAHHALEQLIRDCN 1356

  Fly   247 --VEEQEITQYLIHLQNSLVNRTP--NIVKPSRRVIKEGVL------------QKITHKGTEIKR 295
              |:....|:.||:|...:.....  .::..||.::|.|.|            :|:..:...:..
Human  1357 NNVQSMRRTEELIYLSQKIEFECKIFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHL 1421

  Fly   296 Y--CVLMS-----DIFMYCKMIKERAPNTVVENSLECCCIFPLKKCKVYEMLPGNFK------LT 347
            :  |:|:|     ..|    ::.:.||.:.:..          :||::  .|.|..|      |.
Human  1422 FNDCLLLSRPREGSRF----LVFDHAPFSSIRG----------EKCEM--KLHGPHKNLFRLFLR 1470

  Fly   348 CQSDG----IIFGSGDVQLSRTWVGFI---RDAIDL-------HVQCRKTLRKDSSKRTPIRKKD 398
            ..:.|    .:|.:........|:..:   |:.:||       .|||.:..:...:....:.|.|
Human  1471 QNTQGAQAEFLFRTETQSEKLRWISALAMPREELDLLECYNSPQVQCLRAYKPRENDELALEKAD 1535

  Fly   399 M 399
            :
Human  1536 V 1536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 62/189 (33%)
PH-like 269..>311 CDD:302622 10/60 (17%)
PH 277..374 CDD:278594 20/128 (16%)
ARHGEF5NP_005426.2 ARHGEF5_35 1..478 CDD:292081
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..246
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..455
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..1072
RhoGEF 1178..1356 CDD:279015 61/188 (32%)
PH_ephexin 1378..1504 CDD:269929 22/141 (16%)
PH 1391..1497 CDD:278594 19/121 (16%)
SH3_ARHGEF5_19 1514..1568 CDD:212873 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.