DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and net1

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001072884.2 Gene:net1 / 780346 XenbaseID:XB-GENE-487220 Length:585 Species:Xenopus tropicalis


Alignment Length:455 Identity:94/455 - (20%)
Similarity:179/455 - (39%) Gaps:102/455 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KSRRKV--CSMLDSNNSSPIGSPNPDAGKRLGFRRQAIQEIISSEKSYLEQLELLMNFFVRPLKE 102
            |.|..|  ..|||.|....:.:      |.:. |::||.|:...|:..::.|:|....:..|:.:
 Frog   157 KRRNSVLWSEMLDINMKESLST------KEIK-RQEAIFEMTKGEQDLIDDLKLARKAYHDPMLK 214

  Fly   103 QAIIDCSNHTLLFGQIEMIHNLNGEFLREL------EANMENVAHAFLKMAPFFKLYSVYAFDYR 161
            .:|:.....|.:||.::....|:.|.|.:|      :..:..:....:...|....|..|..:..
 Frog   215 LSIMSEEELTQIFGDLDSYIPLHEELLAKLGEATKADGTVGQIGPILINWLPRLNAYKEYCSNQL 279

  Fly   162 GALFIIQDLISKNPVFRK---FLEQTESRPEVQRKLN--SLMIVPIQRVPRYKLLLEQVLLYTSP 221
            .|    :.|:.|..:.|:   ||::....| ..|||:  |.:.:|..|:.:|.|||:::|.:|..
 Frog   280 AA----KALLDKKKLDRRVQDFLQRCLESP-FSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPK 339

  Fly   222 ADADYKLLKESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNI-VKPSRRVIKEGVLQ- 284
            ...|.|.|.|::..|:...:.||....|.| .||.|.....|.::..:: ::.|:.::..|.|: 
 Frog   340 DHPDTKGLHEALCLIQGVLTDINLKKGESE-CQYYIDKLEYLDDKQKDLRIESSKALLCHGELKN 403

  Fly   285 KITHKGTEIKRYCVLMSDIFMYCKMIKERAPNTVVENSLECCCIF----PLKKCKVYEMLPGNFK 345
            |..|     |.:..|..|:.:..:        .|:.|..:...::    |::...:.::..|:.:
 Frog   404 KNGH-----KLFLFLFQDVLVLTR--------PVIRNEHQHFQVYRQPIPVQDLVLEDLQDGDVR 455

  Fly   346 LTCQSDGI---------IF-------GSG--------DVQLSRTWVGFIRDAIDLHVQCRKTLRK 386
            :.....|.         ||       |:|        ||...:.|:..|:.|:..:.|...|.:|
 Frog   456 MGGSFRGAFSNSDKAKNIFRVRFKDAGAGQSHTLQANDVFHKQQWLNCIKTAVSPYQQASPTEQK 520

  Fly   387 DSSKRTPIRKKDMKKFGADYVLSPNKRKCEYDTVFRNKNRSTDSEEETEDSACFSRKRKVASGIL 451
            :                    |.....:||     .|...:|:|::.        |:....|||:
 Frog   521 E--------------------LPDLNEECE-----ENNPPATNSKDH--------RRSSTISGIM 552

  Fly   452  451
             Frog   553  552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 42/180 (23%)
PH-like 269..>311 CDD:302622 8/43 (19%)
PH 277..374 CDD:278594 20/125 (16%)
net1NP_001072884.2 RhoGEF 186..362 CDD:366202 42/180 (23%)
PH_Net1 376..510 CDD:270044 23/146 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.