DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Arhgef16

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001121063.1 Gene:Arhgef16 / 687105 RGDID:1588981 Length:709 Species:Rattus norvegicus


Alignment Length:269 Identity:70/269 - (26%)
Similarity:119/269 - (44%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEAN 135
            |::||.||::||.|||..|::|:|.|::..:.:..:..:.|..||..|..:...:.:|...||..
  Rat   285 RQEAIFEILTSEFSYLHSLKILVNEFLQSQELKTTMTQTEHHHLFSNISDVLAASQKFFESLEQR 349

  Fly   136 ------MENVA-----HAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPE 189
                  :|:::     ||.....|:....|...:..|    .:|.|.:.|..||:.|.:.|..|.
  Rat   350 HKAQVCVEDISDILEDHAENHFHPYIAYCSNEVYQQR----TLQKLSNSNTAFREVLREIEKLPA 410

  Fly   190 V-QRKLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEIT 253
            . ...:.|.:|:|:|||.|..||.:.:.|.|......||....::|.|.......|....:.|.|
  Rat   411 CGGLPMISFLILPMQRVTRLPLLTDTLCLKTQGHPERYKAASRALKAISKLVKQCNEGAHKMERT 475

  Fly   254 Q--YLIHLQNSL--VNRTPNIVKPSRRVIKEG---------VLQKITHKGTEIKRYCVLMSDIFM 305
            :  |.:|:|...  |...| ::..||.::|.|         :.:||..:.|   .|..|.:|:.:
  Rat   476 EQMYTLHMQLDFGKVKSLP-LISASRWLLKRGELLLLEESSIFRKIASRPT---CYLFLFNDVLV 536

  Fly   306 YCKMIKERA 314
            ..|...|.:
  Rat   537 VTKKKSEES 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 49/181 (27%)
PH-like 269..>311 CDD:302622 11/50 (22%)
PH 277..374 CDD:278594 10/47 (21%)
Arhgef16NP_001121063.1 RhoGEF 288..466 CDD:395496 49/181 (27%)
PH_ephexin 489..622 CDD:269929 14/61 (23%)
SH3_ARHGEF16_26 633..684 CDD:212871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.