DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and prex1

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_699627.3 Gene:prex1 / 570984 ZFINID:ZDB-GENE-030131-1428 Length:1622 Species:Danio rerio


Alignment Length:266 Identity:68/266 - (25%)
Similarity:133/266 - (50%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DAGKRLGFRRQAIQEIISSEKSYLEQLELLMNFFVRPLKE----QAIIDCSNHTLLFGQIEMIHN 123
            |:.::|..|...:.||:::|:.|:..|..|.:.|::.:::    |..:......:||..||.|.:
Zfish    21 DSDRQLRLRLCVLNEILNTERDYVRNLTFLQSAFLQRIRQTAENQQCLTQEQVKVLFSNIESILD 85

  Fly   124 LNGEFLRELEANME-------NVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFL 181
            ::.|||..|:|:::       ::.|.||:....|.:|..|..::..||.::.:| :|.|..|.||
Zfish    86 VHREFLSTLDASLQPEPQAHHSLGHVFLQFKVRFSVYGEYCSNHEKALRLLMEL-NKIPHIRAFL 149

  Fly   182 --------EQTESRPEVQRKLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEA 238
                    :::...|     |...::.||||:.:|.|||.::|..|....:||..::|:::.::|
Zfish   150 LHLMLLGGKKSTDVP-----LEGYLLSPIQRICKYPLLLRELLKRTPKKHSDYPAVEEALQAMKA 209

  Fly   239 TASHINTCVEEQEITQYLIHLQNSLVN-RTPNIVKPSRRVIKEGVLQKITHKGTEIKRYCVLMSD 302
            ...:||....:.|..:.|..||:.:.. ...|:......::.:|.|.||: .|...:|...|..:
Zfish   210 VCCNINETKRQMEKLEALEILQSHIEGWEGTNLTDICTELLLQGNLLKIS-AGNIQERVFFLFDN 273

  Fly   303 IFMYCK 308
            :.:|||
Zfish   274 LLVYCK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 48/188 (26%)
PH-like 269..>311 CDD:302622 11/40 (28%)
PH 277..374 CDD:278594 10/32 (31%)
prex1XP_699627.3 RhoGEF 32..216 CDD:279015 49/189 (26%)
PH_Collybistin_ASEF 221..372 CDD:269931 15/60 (25%)
PH 249..363 CDD:278594 10/32 (31%)
DEP 390..470 CDD:295306
DEP_2_P-Rex 482..574 CDD:239887
PDZ 600..678 CDD:214570
PDZ_signaling 684..745 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.