DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and arhgef19

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_005162265.1 Gene:arhgef19 / 569202 ZFINID:ZDB-GENE-090313-243 Length:958 Species:Danio rerio


Alignment Length:381 Identity:83/381 - (21%)
Similarity:158/381 - (41%) Gaps:69/381 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEANM 136
            ::|..|:::||.||:..|.:.::.|:...:....:.......||.::..:..::..||::||..:
Zfish   533 QEAKFELVTSEASYIRSLSIAVDHFMMSSELCECLGTQERQWLFSKLPDVKEVSERFLQDLERRL 597

  Fly   137 E------NVAHAFLKMAPFF-KLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQR-K 193
            |      :|....|...|.. ::|..|..:........|.|:.:|..|...|.:.|..|..|| .
Zfish   598 EGDILRFDVCDIVLDHCPALRRVYLPYVTNQAYQEQTYQRLLQENARFPGILARLEEDPICQRLP 662

  Fly   194 LNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQYLIH 258
            |.|.:|:|.||:.|.|:|:|.:|..|:|...|.....:::.|::......|:.|:..:..:.|||
Zfish   663 LTSFLILPFQRITRLKMLVENILKRTTPGSRDEDTATKALNELKKIIKECNSSVQSMKRMEELIH 727

  Fly   259 LQNSL--VNRTPNIVKPSRRVIKEGVL-----QKITHKGTEIK-----------RYCVLMSD--- 302
            |...:  ..:...::..||.::|.|.|     |.::..|::.|           ..|:|:|.   
Zfish   728 LNKKIHFEGKIFPLISQSRWLVKHGELLEVDTQNLSISGSKFKLTTRPVYLHLFNDCLLLSRRKE 792

  Fly   303 -----IFMYCKM----IKERAPNTVVENSLECCC--IFPLKKCKVYEMLPGNFKLTCQSDGIIFG 356
                 :|::.|:    :|:      :...|:...  ||.|:.|:..::          ...|:..
Zfish   793 SWKFMVFVHAKIEDLKVKD------LSQKLQGISGFIFYLQLCEGQQL----------KHQILLK 841

  Fly   357 SGDVQLSRTWVG--FIRD---AI-------DL-HVQCRKTLRKDSSKRTPIRKKDM 399
            |......:.|:.  |..|   ||       || .|||.::.:........:.|.|:
Zfish   842 SPTESSKQRWITAMFPSDPTTAIEQTNENDDLSQVQCIRSYQAQEHDELTLEKADI 897

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 44/177 (25%)
PH-like 269..>311 CDD:302622 13/69 (19%)
PH 277..374 CDD:278594 22/131 (17%)
arhgef19XP_005162265.1 RhoGEF 537..713 CDD:279015 43/175 (25%)
PH_ephexin 735..862 CDD:269929 24/142 (17%)
PH 748..855 CDD:278594 20/122 (16%)
SH3_ARHGEF5_19 875..929 CDD:212873 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.