DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and plekhg7

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001315140.1 Gene:plekhg7 / 562798 ZFINID:ZDB-GENE-070410-15 Length:769 Species:Danio rerio


Alignment Length:441 Identity:83/441 - (18%)
Similarity:167/441 - (37%) Gaps:112/441 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RQAIQEIISSEKSY-LEQLELLMNFFVRPLKE----QAIIDCSNHTLLFGQIEMIHNLNGEFLRE 131
            ::||.|:.:||..| |:||.:|...|:..|.:    |.:.|..:.. ||..:..:..::..||..
Zfish   373 QEAIWELFTSECVYFLDQLMVLKEVFLTTLSDLQTRQCLQDIDSWR-LFANLNELCLVSFGFLTS 436

  Fly   132 L------------------------EANMENVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLIS 172
            |                        :|..|::.|...|          |..:|..|:..: |.:.
Zfish   437 LLRVIKEMWTDPDSCSTQSLHDLFRKAFSESICHCLQK----------YCLNYSTAILYL-DSLK 490

  Fly   173 KNPVFRKFLEQTESRPEVQR-KLNSLMIVPIQRVPRYKLLLEQV-LLYTSPADAD-----YKLLK 230
            ....|..|::..|...|.:| :|..|::||:||..||.|||:.: ....|.|:.:     ..|:.
Zfish   491 LREDFGSFVKWCERNEECRRLQLKDLLVVPLQRFTRYPLLLKNIGKRSCSKAEENTIQSIVDLVD 555

  Fly   231 ESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQKITHKGTEIKR 295
            .::.::|.....::...:.:::.:.|:.|.....::..::.:..:.::|...|:.:.     |.|
Zfish   556 RAIYDLEGKVKWLDNYQKVKQLKETLVWLPVWESDKRAHVPESLKHLLKPVTLENLV-----INR 615

  Fly   296 YCVLMSDIFMYCKMIKERAPNTVVENSLECCCIFPLKKCKVYEMLPGNFKLTC-------QSDGI 353
            ..:....:|:             :||:         |:.:||..|...|.|..       |..|:
Zfish   616 SLLHDGKLFL-------------IENT---------KQQEVYLFLFDEFLLITKIKRNKKQKSGV 658

  Fly   354 I-FGSGDVQLSRTWVGFIRDAIDLHVQ--CRKTLRKDSSKRTPIRKKDMKKFGADYVLSPNKRKC 415
            : |.:|             ..::|.:|  |..|:.........::.|::.:..|.....||    
Zfish   659 VDFAAG-------------QELELLLQEGCSFTVLDQPISLDRLQLKNIDQLNATASTLPN---- 706

  Fly   416 EYDTVFRNKNR--------STDSEEETEDSACFSRKRKVASGILRAPNGNP 458
              ..:..::||        ...::.|:...|..|...|..|.:|:..:.:|
Zfish   707 --SFIIMHQNRYQQCIAVFVLQAQSESTKKAWMSEIEKAVSSLLKQDSLHP 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 47/205 (23%)
PH-like 269..>311 CDD:302622 5/41 (12%)
PH 277..374 CDD:278594 17/104 (16%)
plekhg7NP_001315140.1 DUF4675 122..>245 CDD:292348
RhoGEF 375..538 CDD:279015 43/174 (25%)
PH_PLEKHG7 616..741 CDD:270065 26/165 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.