DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and arhgef2

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_021328624.1 Gene:arhgef2 / 561276 ZFINID:ZDB-GENE-030717-1 Length:872 Species:Danio rerio


Alignment Length:287 Identity:61/287 - (21%)
Similarity:131/287 - (45%) Gaps:38/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NSSPIGSPNPDAGKRLGFRRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQ 117
            :||.:.|...|..|    |:..|.|:|.:|.:::..|.::...|.|.:.|:.:::......:|..
Zfish   230 DSSYLQSQRKDVIK----RQDVIYELIQTEFNHVRTLRIMEGVFRRGMLEEVMMEMGVVHAIFPC 290

  Fly   118 IEMIHNLNGEFLREL-------EANMENVAHAFLKMAPFF-------------KLYSVYAFDYRG 162
            ::.:..::..||.:|       .|:..|......|:....             |.|..:...:..
Zfish   291 LDQLLLIHTNFLSQLLQRRSNSLASNSNRNFTIQKLGDILVEQFSGQNAEDMRKCYVEFCSRHLK 355

  Fly   163 ALFIIQDLISKNPVFRKFLEQTESRPEVQRK--LNSLMIVPIQRVPRYKLLLEQVLLYTSPADAD 225
            |:.:.::|::::..|::|:.:. ||..:.|:  :...:::..||:.:|.:|::::|..|...:.:
Zfish   356 AVKLYKELLARDKRFQQFIRRV-SRGSLLRRHGVQECILLVTQRITKYPVLMQRILDNTKGNEEE 419

  Fly   226 YKLLKESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPS----------RRVIKE 280
            .|.|.:|:..|......::..|:|.|..|.|..:|:.|..|....||..          |.:|.|
Zfish   420 SKSLAQSLTLIRELLCSVDQQVQELERAQRLQEIQSRLDPRAETKVKGGGVFHGAELLRRGLIHE 484

  Fly   281 GVLQKITHKGTEIKR-YCVLMSDIFMY 306
            |.|...|.:|:.:|. :.:||:|:.::
Zfish   485 GALLWKTAQGSRLKDVHVLLMTDVLVF 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 34/191 (18%)
PH-like 269..>311 CDD:302622 13/49 (27%)
PH 277..374 CDD:278594 10/31 (32%)
arhgef2XP_021328624.1 C1 47..92 CDD:237996
RhoGEF 244..438 CDD:238091 35/194 (18%)
PH-like 478..595 CDD:327399 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.