DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and fgd1

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_688794.4 Gene:fgd1 / 560305 ZFINID:ZDB-GENE-081104-33 Length:995 Species:Danio rerio


Alignment Length:408 Identity:104/408 - (25%)
Similarity:183/408 - (44%) Gaps:76/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DSNNSSPIG-SPNPDAGKRLGFRRQAIQ--------EIISSEKSYLEQLELLMNFFVRPLKEQA- 104
            |.:..:|:. .|.|.| :|......::|        |::.:||:|:.:|.||...|...|.|:| 
Zfish   390 DESEMNPMALQPLPKA-ERQDSTEMSVQQRVFNIANELLHTEKAYVSRLHLLDQVFCAQLMEEAR 453

  Fly   105 ---IIDCSNHTLLFGQIEMIHNLNGEF-LRELEANME------NVAHAFLKMAPFFKLYSVYAFD 159
               ...|.....:|..|..|:..:.:| |..||..||      .:.....|:|||.|:|..|..:
Zfish   454 ARSSFPCEMVMGIFSNICSIYCFHQQFLLPALEKRMEEWDLNPRIGDILQKLAPFLKMYGEYVKN 518

  Fly   160 YRGALFIIQDLISKNPVFRKFLEQTESRPEVQRK-------LNSLMIVPIQRVPRYKLLLEQVLL 217
            :..|:.::...:.::..|:..:.      .:|::       |...|:.|:||:|||:|||:. .|
Zfish   519 FDRAMELVNTWMQRSSQFKTIIH------NIQKEEMCGNLTLQHHMLEPVQRIPRYELLLKD-YL 576

  Fly   218 YTSPADA-DYKLLKESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPSRRVIKEG 281
            :..|.|| |:|..::|::.|...|.|.|..:.:.|..:.|:.:. .|:....:||.|:..:||||
Zfish   577 HRLPEDADDFKDAQKSLELIATAAEHSNAAIRKMERMRKLLKVY-ELLGGEEDIVNPTNELIKEG 640

  Fly   282 VLQKITHK-GTEIKRYCVLMSDIFMYC----KMIKE----RAPNTVVENSLECCCIFPLKKCKVY 337
            .:.|::.| ||...||.:|.:|..:||    ::|.:    ||...|  :.:|      ||:....
Zfish   641 HILKLSAKNGTSQDRYLILFNDRLLYCVPKLRLIGQKFGVRARIDV--DGME------LKETSSM 697

  Fly   338 EMLPGNFKLTCQSDGIIFGSGDVQLSRTWVGFIRDAIDLHVQCRKTLR----------------- 385
            . :|..|.::.:...:...:...:..|.|:..|:..|..|.|..:|.|                 
Zfish   698 N-VPRTFLVSGKQRSLELQARTEEEKRDWIQAIQATIQRHEQTLETFRMLNCSFREEDLTPPNSP 761

  Fly   386 --KDSSKR--TPIRKKDM 399
              .:..||  ||||:|::
Zfish   762 NCSELGKRAPTPIREKEV 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 53/196 (27%)
PH-like 269..>311 CDD:302622 17/46 (37%)
PH 277..374 CDD:278594 26/105 (25%)
fgd1XP_688794.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.