DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and si:ch73-15b2.5

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_686873.2 Gene:si:ch73-15b2.5 / 558551 ZFINID:ZDB-GENE-030131-5406 Length:532 Species:Danio rerio


Alignment Length:255 Identity:68/255 - (26%)
Similarity:127/255 - (49%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEAN- 135
            ::|:.|:|.||.||.:.|.:.:|.|....:.:.|:....|.:||..::.:..::..||::||:: 
Zfish   208 QEAMFELIVSEASYQKSLIVALNVFQCSAELKHILTRVQHHVLFSNLKDVCRVSERFLQDLESHL 272

  Fly   136 -----MENVAHAFLK-MAPFFKLYSVYAFD--YRGALFIIQDLISKNPVFRKFLEQTESRPEVQR 192
                 |..|....|. ...|.::|..|..:  |:.||  :..|:.:|..|...|::.|..|:.||
Zfish   273 RQDVVMSQVGDVVLNHQKSFQQVYVPYITNMMYQEAL--VTQLLQENRKFAPILKKLEKDPQCQR 335

  Fly   193 K-LNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQYL 256
            : |.|.:|:|.||:.|..||||.||........:...:||:::.:.......:|.|::.:.|:.|
Zfish   336 QTLKSFLILPFQRITRITLLLENVLKRARGVSLNVPNVKEAIEAVRKIVEECDTRVQKMKRTELL 400

  Fly   257 IHLQNSL----VNRTPNIVKPSRRVIKEGVLQKI----THKGTEIKR---YCVLMSDIFM 305
            :.|...:    |...|.|.: .|.:::||.|:::    .||.:.:.|   |..|.:|:.:
Zfish   401 VSLDKLVDFGNVKAVPLITR-GRHLVQEGTLKQLIIGGNHKASIVSRKDLYIHLFNDLLL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 50/179 (28%)
PH-like 269..>311 CDD:302622 11/44 (25%)
PH 277..374 CDD:278594 9/36 (25%)
si:ch73-15b2.5XP_686873.2 RhoGEF 210..388 CDD:279015 50/179 (28%)
PH-like 412..532 CDD:302622 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.