DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and arhgef1b

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_021322373.1 Gene:arhgef1b / 557983 ZFINID:ZDB-GENE-060616-136 Length:1082 Species:Danio rerio


Alignment Length:590 Identity:120/590 - (20%)
Similarity:209/590 - (35%) Gaps:189/590 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FIHSPQTPLSFSR--ELRQ-VLQERNLLTAKSRRKVCSMLDSNNSSPIGSPNPDAGKRLGFRRQA 74
            |:.:||......|  ||.| .|..|.|.:::|..|:                   .|:...|::.
Zfish   482 FVPAPQQEEIEPRLLELEQDPLNWRELASSESLHKL-------------------SKKEAKRQEV 527

  Fly    75 IQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMI---HNLNGEFLRELEANM 136
            |.|:..:|::::..|.:|...|.|||::|..:..:....:|..::.|   |.:..|.|::|....
Zfish   528 INELFVTEQAHVRMLSVLQTVFSRPLEKQEYMTANEVATIFSSLDDIIEMHYVFYENLKKLREED 592

  Fly   137 ENVAHA----------------FLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTE 185
            |.:...                |.|:...|..|..:|.:.      |:....|:|.|..|:.:.|
Zfish   593 EYIVKTISTPLLNRFSGSEGEWFQKLTARFCSYQSWALEQ------IKSRQKKDPRFNAFILEAE 651

  Fly   186 SRPEVQR-KLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKL--LKESVKEIEATASHINTCV 247
            |:|:.:| :|..::.:.:||:.:|.||||.:...|..|....|:  ..||.::|   .:|:|..|
Zfish   652 SKPQCRRLQLKDIIPIEMQRLTKYPLLLENIAKNTEDATEKEKINQAAESCRKI---LNHVNEEV 713

  Fly   248 EEQE----ITQYLIHL-------QNSLVNRTPNIVKPSRRVIKEGVLQKITHKGTEIKRYCVLMS 301
            ::.|    :..|...|       .|.|.:....|...:|.::.||.|.....|...|..:|||:|
Zfish   714 KQMENLLILKDYQRRLDTSGLKPSNELYSEYKTIDLTNRTMLFEGPLTWRVTKEKAIDVHCVLLS 778

  Fly   302 DIFMYCK------MIK-ERAPNTVVENSLECCCIFPLKKCK-------------VYEMLPGN--- 343
            |:.:..:      ::| :...|..|:...:  .:.|:.|.:             :|.:...:   
Zfish   779 DLLVLFQKQDDKMLLKCQSKSNIAVQEGKQ--MLSPIIKLESVFLREVATDPKALYVIFTWDSGA 841

  Fly   344 --FKLTCQSDGIIFGSGDVQLSRTWVGFIRDAIDLHVQCRKTLRKDSSKRTPIRKKDMKKFGADY 406
              ::|..||.|         ..:.|...|:.|:|       .|:|.|...|.:.:.         
Zfish   842 QIYELVAQSVG---------ERKNWTEAIKSAVD-------ELKKASKSNTKLERN--------- 881

  Fly   407 VLSPNKRKCEYDTVFRNKNRSTDSEEETEDSACFSRKRKVASGILRAPNGNPMGKASSSSSSSVS 471
                                              ||...|       ||                
Zfish   882 ----------------------------------SRAGSV-------PN---------------- 889

  Fly   472 MKRVAPPPPAPPPPPAVQMRHQPGRPGELATASKENRISKLYKKIAAGDK------VANVRGILK 530
              .:|.|...|..||.....:    .|||.    :||:.:..:||...|.      .||...:|.
Zfish   890 --NIAVPLYGPAHPPLSPTEN----GGELL----KNRVGRFSEKIRESDPPLIDYLAANGFDLLT 944

  Fly   531 RSNVP 535
            .|:.|
Zfish   945 HSHTP 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 46/191 (24%)
PH-like 269..>311 CDD:302622 12/47 (26%)
PH 277..374 CDD:278594 22/121 (18%)
arhgef1bXP_021322373.1 RGS_p115RhoGEF 74..266 CDD:188709
RhoGEF 524..710 CDD:238091 47/194 (24%)
PH_p115RhoGEF 744..868 CDD:275429 26/141 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.