DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and FGD6

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_060821.3 Gene:FGD6 / 55785 HGNCID:21740 Length:1430 Species:Homo sapiens


Alignment Length:564 Identity:126/564 - (22%)
Similarity:220/564 - (39%) Gaps:146/564 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DSNNSSPIGSPNP-------DAGKRLGFRRQAIQEIISSEKSYLEQLELL-MNF----------F 96
            |.::.|..|.|:|       |.|.:......| :||:||||.:::.|:|| ::|          .
Human   845 DVSSESSKGEPDPLEDKQDEDNGMKSKVHHIA-KEIMSSEKVFVDVLKLLHIDFRDAVAHASRQL 908

  Fly    97 VRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEANM------ENVAHAFLKMAPFFKLYSV 155
            .:|:.|..|:   |..|.:  :..::.||.:.|:|||..|      :.:|..|:|..|:.|:||.
Human   909 GKPVIEDRIL---NQILYY--LPQLYELNRDLLKELEERMLHWTEQQRIADIFVKKGPYLKMYST 968

  Fly   156 YAFDYRGALFIIQDLISKNPVFRKFLEQTESRPE-VQRKLNSLMIVPIQRVPRYKLLLEQVLLYT 219
            |..::...:.::.:...|||.|...:.:.|..|. ....|...::.|:||:|:|:|||...|...
Human   969 YIKEFDKNIALLDEQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNL 1033

  Fly   220 SPADADYKLLKESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQ 284
            .....||:..::::..:...|:|.|..:::.:..|.|:.:|.|| |....||:|.|..:|||:|.
Human  1034 IEDAGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSL-NGHHEIVQPGRVFLKEGILM 1097

  Fly   285 KITHKGTEIKRYCVLMSDIFMYCKMIKERAPNTVVENSL-ECCCIFPLKKCKV----YEMLPGNF 344
            |::.|..: .|...|.:|..:|         .|.|::.: :...:..|...||    .|......
Human  1098 KLSRKVMQ-PRMFFLFNDALLY---------TTPVQSGMYKLNNMLSLAGMKVRKPTQEAYQNEL 1152

  Fly   345 KLTCQSDGIIFGSGDVQLSRTWVGFIRDAIDLHVQCRKTL-------RKDSSKR---TPIRKK-- 397
            |:.......|..:........|:..|..||:.:.:.|.|.       ..||..:   :|:..|  
Human  1153 KIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCPSRSLDEADSENKEEVSPLGSKAP 1217

  Fly   398 --------------------------------------DMKKFGADYVLSPNKRKCEYDTVFRNK 424
                                                  ...|:|.||:.:...|.||:       
Human  1218 IWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQPARVCEH------- 1275

  Fly   425 NRSTDSEEETEDSACFSRKRKVASGILRAPN-GNPMGKASSSSSSSVSMKRVAPPPPAPPPPPAV 488
                          ||...:|:..  ..:|. |:| |...|.||:..|:....|           
Human  1276 --------------CFQELQKLDH--QHSPRIGSP-GNHKSPSSALSSVLHSIP----------- 1312

  Fly   489 QMRHQPGRPGELATASKENRISKLYKKIAAGDKVANVRGILKRS 532
                 .||        |:.:|....|:::|..:.:::.|.|.||
Human  1313 -----SGR--------KQKKIPAALKEVSANTEDSSMSGYLYRS 1343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 51/187 (27%)
PH-like 269..>311 CDD:302622 14/41 (34%)
PH 277..374 CDD:278594 20/101 (20%)
FGD6NP_060821.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..351
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 695..739
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 800..869 7/23 (30%)
RhoGEF 875..1059 CDD:279015 51/189 (27%)
PH1_FGD6 1077..1199 CDD:275436 30/132 (23%)
PH 1092..1183 CDD:278594 21/100 (21%)
FYVE_FGD6 1217..1277 CDD:277282 7/80 (9%)
PH 1336..1426 CDD:278594 4/8 (50%)
PH2_FGD5_FGD6 1336..1424 CDD:270057 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.