DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Fgd6

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001131117.1 Gene:Fgd6 / 500824 RGDID:1565609 Length:1406 Species:Rattus norvegicus


Alignment Length:567 Identity:126/567 - (22%)
Similarity:219/567 - (38%) Gaps:153/567 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DSNNSSPIGSPNP-------DAGKRLGFRRQAIQEIISSEKSYLEQLELL-MNF----------F 96
            |.::.|..|.|:|       |||.:......| :||:||||.:::.|:|| ::|          .
  Rat   822 DVSSESSKGEPDPLEDKQDEDAGMKSKVHHIA-KEIMSSEKVFVDVLKLLHIDFRGAVAHASRQL 885

  Fly    97 VRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELE------ANMENVAHAFLKMAPFFKLYSV 155
            .:|:.|..|:   |..|.:  :..::.||.:.|:|||      |..:.:|..|:|..|:.|:||:
  Rat   886 GKPVIEDRIL---NQILYY--LPQLYELNRDLLKELEERMLSWAEQQRIADIFVKKGPYLKMYSM 945

  Fly   156 YAFDYRGALFIIQDLISKNPVFRKFLEQTESRPE-VQRKLNSLMIVPIQRVPRYKLLLEQVLLYT 219
            |..::...:.::.:...||..|...:.:.|..|. ....|...::.|:||:|:|:|||...|...
  Rat   946 YIKEFDKNIALLDEQCKKNSGFATVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNL 1010

  Fly   220 SPADADYKLLKESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQ 284
            .....|::..::::..:...|:|.|..:::.:..|.|:.:|.||... ..||:|.|..:|||:|.
  Rat  1011 LEDSVDHRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLSGH-HEIVQPGRVFLKEGILM 1074

  Fly   285 KITHKGTEIKRYCVLMSDIFMYCK-----MIKERAPNTVVENSLECCCIFPLKKCKV----YEML 340
            |::.|..: .|...|.:|..:|..     |.|       :.|.|.      |...||    .|..
  Rat  1075 KLSRKVMQ-PRMIFLFNDALLYTTPMQSGMYK-------LNNMLS------LAGMKVRKPTQEAY 1125

  Fly   341 PGNFKLTCQSDGIIFGSGDVQLSRTWVGFIRDAIDLHVQCR------KTLRKDSSKR---TPIRK 396
            ....|:.......|..:........|:..|..||:.:.:.|      ::|.:||.::   :|:..
  Rat  1126 QNELKIESVERSFILSASSASERDDWLEAISRAIEEYAKKRITFCPSRSLDEDSERKEEVSPLGA 1190

  Fly   397 K----------------------------------------DMKKFGADYVLSPNKRKCEYDTVF 421
            |                                        ...|.|.||:.....|.||     
  Rat  1191 KAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKCGLDYLKGQPARVCE----- 1250

  Fly   422 RNKNRSTDSEEETEDSACFSRKRKVASGILRAPN-GNPMGKASSSSSSSVSMKRVAPPPPAPPPP 485
                            .||...:|:...:  :|. |:| |...|.||:..|:....|        
  Rat  1251 ----------------LCFQELQKLDHQL--SPRIGSP-GNHKSPSSALSSVLHSIP-------- 1288

  Fly   486 PAVQMRHQPGRPGELATASKENRISKLYKKIAAGDKVANVRGILKRS 532
                    .||        |:.:|....|:::|..:.:.:.|.|.||
  Rat  1289 --------SGR--------KQKKIPAALKEVSANTEDSTMSGYLYRS 1319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 49/187 (26%)
PH-like 269..>311 CDD:302622 15/46 (33%)
PH 277..374 CDD:278594 22/105 (21%)
Fgd6NP_001131117.1 RhoGEF 852..1036 CDD:279015 49/189 (26%)
PH1_FGD6 1054..1176 CDD:275436 30/136 (22%)
PH 1069..1160 CDD:278594 23/104 (22%)
FYVE_FGD6 1193..1253 CDD:277282 7/80 (9%)
PH 1311..1402 CDD:278594 4/9 (44%)
PH2_FGD5_FGD6 1312..1400 CDD:270057 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X316
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.