DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and si:dkey-172h23.2

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_957093.1 Gene:si:dkey-172h23.2 / 393772 ZFINID:ZDB-GENE-141212-258 Length:221 Species:Danio rerio


Alignment Length:85 Identity:20/85 - (23%)
Similarity:31/85 - (36%) Gaps:25/85 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GNGFIHSPQ-TPLSFS--RELRQVLQERNLLTAKSRRKVCSMLDSNNSSPIGSPNPDAGKRLGFR 71
            ||.....|| |.|.|:  |.|.:|  .|.||.....|:..|:.:....:|:              
Zfish   156 GNNTRMDPQETLLHFAARRGLSKV--ARFLLKQPGAREALSLRNRQGDTPV-------------- 204

  Fly    72 RQAIQEIISSEKSYLEQLEL 91
                  :|:..:.:...|||
Zfish   205 ------LIAQSRGHTALLEL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 4/18 (22%)
PH-like 269..>311 CDD:302622
PH 277..374 CDD:278594
si:dkey-172h23.2NP_957093.1 ANK repeat 163..197 CDD:293786 13/35 (37%)
ANK <165..218 CDD:238125 14/74 (19%)
Ank_4 166..219 CDD:290365 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.