DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and RhoGEF64C

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001261425.1 Gene:RhoGEF64C / 38578 FlyBaseID:FBgn0035574 Length:1984 Species:Drosophila melanogaster


Alignment Length:220 Identity:56/220 - (25%)
Similarity:103/220 - (46%) Gaps:20/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GKRLGFRRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLN---G 126
            ||:...|::.|.||:.:|:.|...|::::..|..|:....::.....:.:|...|.:...|   .
  Fly  1584 GKKRVERKEIITEIVETEEKYGRDLQIILEEFCHPMLVAGLLTQEQLSAIFLNTEDLLENNQTLA 1648

  Fly   127 EFLRE-LEANME---------NVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFL 181
            |.:|: |:.::|         |:...||........:..|.....||..::.:|..:..:.|.||
  Fly  1649 ERMRDALDMSLEQGDDDLLTVNIGRIFLDFTQMLHAFESYCVRQAGASLLLANLEKEKELLRIFL 1713

  Fly   182 EQTESRPEVQRK--LNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHIN 244
            :.::....|.|:  |||.::||:|||.:|.|||.::...|.......:|||::.::||...:|||
  Fly  1714 KVSQMENAVLRRMNLNSFLMVPVQRVTKYPLLLARLYKVTPSHLEGRELLKQAQEKIELHLNHIN 1778

  Fly   245 TCVEEQEITQYLIHLQNSLVNRTPN 269
                 ||.......|...:.:.:||
  Fly  1779 -----QEAKDVPTKLWRRISSSSPN 1798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 46/184 (25%)
PH-like 269..>311 CDD:302622 1/1 (100%)
PH 277..374 CDD:278594
RhoGEF64CNP_001261425.1 RhoGEF 1593..1779 CDD:279015 48/190 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.