DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Fgd1

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_038955799.1 Gene:Fgd1 / 363460 RGDID:1565188 Length:962 Species:Rattus norvegicus


Alignment Length:374 Identity:97/374 - (25%)
Similarity:164/374 - (43%) Gaps:71/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTL--------LFGQIEMIHNLNGEF-LREL 132
            |::.:||:|:.:|.||...|...|.|:|    .|.:.        :|..|..|:..:.:| |.||
  Rat   381 ELLQTEKAYVSRLHLLDQVFCARLLEEA----RNRSSFPADVVHGIFSNICSIYCFHQQFLLPEL 441

  Fly   133 EANME------NVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQ 191
            |..||      .:.....|:|||.|:|..|..::..|:.::.....::..|:..:.      |||
  Rat   442 EKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELVNTWTERSTQFKVIIH------EVQ 500

  Fly   192 RK-------LNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEE 249
            ::       |...|:.|:||:|||:|||:..||.......|.|..::|::.|...|.|.|..:.:
  Rat   501 KEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPDSKDAQKSLELIATAAEHSNAAIRK 565

  Fly   250 QEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQKITHK-GTEIKRYCVLMSDIFMYC------ 307
            .|....|:.:. .|:....:||.|::.:||||.:.|::.| ||...||.:|.:|..:||      
  Rat   566 MERMHKLLKVY-ELLGGEEDIVSPTKELIKEGHILKLSAKNGTTQDRYLILFNDRLLYCVPRLRL 629

  Fly   308 --KMIKERAPNTVVENSLECCCIFPLKKCKVYEMLPGNFKLTCQSDGIIFGSGDVQLSRTWVGFI 370
              :....||...|  :.:|      ||:.....| |..|.::.:...:...:...:..:.||..|
  Rat   630 LGQKFSVRARIDV--DGME------LKESSNLNM-PRTFLVSGKQRSLELQARTEEEKKDWVQAI 685

  Fly   371 RDAIDLHVQCRKTLR------------------KDSSKR--TPIRKKDM 399
            ...:..|.|..:|.:                  .|..||  ||||:|::
  Rat   686 NSTLLKHEQTLETFKLLNSTNRDDEDTPPNSPNVDLGKRAPTPIREKEV 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 53/188 (28%)
PH-like 269..>311 CDD:302622 17/50 (34%)
PH 277..374 CDD:278594 26/105 (25%)
Fgd1XP_038955799.1 PHA03247 <7..360 CDD:223021
RhoGEF 377..560 CDD:238091 53/188 (28%)
PH1_FGD1 592..699 CDD:275392 28/115 (24%)
FYVE_FGD1_2_4 726..790 CDD:277280 5/9 (56%)
PH2_FGD1-4 816..921 CDD:270056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.