DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Plekhf2

DIOPT Version :10

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001102125.1 Gene:Plekhf2 / 362484 RGDID:1312029 Length:249 Species:Rattus norvegicus


Alignment Length:253 Identity:53/253 - (20%)
Similarity:88/253 - (34%) Gaps:82/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LQNSLVN-RTPNIVK------------PSRRVIKEGVLQKITHKGTEIKRYCVLMSDIFMYCKMI 310
            |.||..| |..:||:            |.|.:|.||||.|:..|..:.::: .|.:||.:|..::
  Rat     5 LANSEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQF-FLFNDILVYGNIV 68

  Fly   311 KER----------APNTVV-----ENSLECCCIF--PLKKCKVY--------EMLPGNFKLTCQS 350
            .::          ..|..:     |..|....:.  |.|...||        |.:  |....|.|
  Rat    69 IQKKKYNKQHIIPLENVTIDSIKDEGELRNGWLIKTPTKSFAVYAATATEKSEWM--NHINKCVS 131

  Fly   351 DGIIFGSGDV---QLSRTWVGFIRDAIDLHVQ------------CRK--------------TLRK 386
            | ::..||..   :.:..||......:.:..|            |||              .|..
  Rat   132 D-LLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPS 195

  Fly   387 DSSKRTPIRKKDMKKFGADYVLSPNKRKCE------YDTVFRNKNRSTDSEEETEDSA 438
            .|||  |:|..|   |..|.:.:.:...|:      |....::.......:::.:||:
  Rat   196 QSSK--PVRICD---FCYDLLSTGDMAACQPTRSDSYSQSLKSPLNDASDDDDDDDSS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:459876
PH-like 269..>311 CDD:473070 15/53 (28%)
PH 277..374 CDD:459697 27/124 (22%)
Plekhf2NP_001102125.1 PH_Phafin2-like 7..129 CDD:269927 28/124 (23%)
FYVE_PKHF2 148..211 CDD:277294 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.