DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Fgd3

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_008769765.1 Gene:Fgd3 / 361223 RGDID:1311725 Length:733 Species:Rattus norvegicus


Alignment Length:581 Identity:133/581 - (22%)
Similarity:225/581 - (38%) Gaps:130/581 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PNPDAGKRLGFRRQAI----QEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEM 120
            |..|.|.......|.:    ||::.:|::|:::|.||...|...|.| |.|.....|.:|..|..
  Rat   139 PEEDVGSTQCSDPQKLLHIAQELLHTEEAYVKRLHLLDQVFCAKLTE-AGIPPEVTTGIFSNISS 202

  Fly   121 IHNLNGEFL--------RELEANMENVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVF 177
            |:..:|:||        .|.......:.....|:|||.|:|..|..::..|:.::.....::|.|
  Rat   203 IYRFHGQFLLPGLKKRITEEWDTKPRLGDILQKLAPFLKMYGEYVKNFDRAMGLVSTWTQRSPQF 267

  Fly   178 RKFLEQTESRPEV--QRKLNSLMIVPIQRVPRYKLLLEQVLLYTSPADA-DYKLLKESVKEIEAT 239
            :..: .|..:.||  ...|...|:.|:||||||:|||:. .|...|.|| |.|..:.|::.|...
  Rat   268 KDVI-HTIQKQEVCGNLTLQHHMLEPVQRVPRYELLLKD-YLKRLPRDAPDRKDAERSLELISIA 330

  Fly   240 ASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQKITHK-GTEIKRYCVLMSDI 303
            |.|.|..:.:.|....|:.:...| ....:||.|:..:||||.:||::.| ||...|:..|.:::
  Rat   331 ADHSNAAIRKMEKMHKLLEVYEQL-GGEEDIVNPANELIKEGNIQKLSAKNGTTQDRHLFLFNNV 394

  Fly   304 FMYC-KMIKERAPNTVVENSLECCCIFPLKKCKVYEMLPGN----FKLTCQSDGIIFGSGDVQLS 363
            .:|| ..::.......|...::      :...:|.:::..|    |.:|.:...:...:...:..
  Rat   395 MLYCVPKLRLMGQKFSVREKMD------ISDLQVQDVVKPNAARTFIITGRKRSLELQTRTEEEK 453

  Fly   364 RTWVGFIRDAIDLHVQCRKTLR-------------------------------KDSSKRTP---I 394
            :.|:..|:..::.|.|..:|.|                               .|||..||   .
  Rat   454 KEWIQVIQATVEKHKQKSETFRAFSGACTQEEEPSLSPDQPVLSAGPVEPAGVADSSGGTPGIES 518

  Fly   395 RK------KDMKKFG----ADYVLSPNKRK----------CEYDTVFRNKNRSTDSEEETEDSAC 439
            ||      :|.:|.|    .:...|..||:          |...:.|:.:|    |::......|
  Rat   519 RKLSSKTRRDKEKPGCKSCGETFNSITKRRYRCKLCGEVICRKCSEFKAEN----SKQSRVCREC 579

  Fly   440 FSRKRKVASGILRAPNGNPMGKASSSSSSSVSMKRVAPPPPAPPPPPAVQMRHQPGRPGELATAS 504
            |..:              |:...|.||.:...:|:.|..||:..|.|::..       |.|..:.
  Rat   580 FLEE--------------PLLPTSPSSETPTELKQNAEKPPSVDPRPSLLC-------GTLNLSD 623

  Fly   505 KENRISKLYKKIAAGDKVANVRGILKRS--------------NVPAPNNDHDPSYGFASRY 551
            .....|:::..|...|  ..|..:|..|              |:..|    ||..|..:.|
  Rat   624 NGTAWSEVWAAIPESD--PQVLDLLAGSQAGKLLYSIPLSGCNITVP----DPEEGLEAGY 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 55/184 (30%)
PH-like 269..>311 CDD:302622 16/43 (37%)
PH 277..374 CDD:278594 20/102 (20%)
Fgd3XP_008769765.1 RhoGEF 157..336 CDD:279015 55/181 (30%)
PH-like 367..474 CDD:302622 22/112 (20%)
PH 367..465 CDD:278594 20/103 (19%)
FYVE_FGD3 527..580 CDD:277279 10/56 (18%)
PH2_FGD1-4 606..710 CDD:270056 17/86 (20%)
PH 622..711 CDD:278594 12/63 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X316
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.