DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Arhgef2

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_006232705.1 Gene:Arhgef2 / 310635 RGDID:1304659 Length:1180 Species:Rattus norvegicus


Alignment Length:441 Identity:81/441 - (18%)
Similarity:172/441 - (39%) Gaps:111/441 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QTPLSFSRELRQVL-QERNLLTAKSRR-KVCSMLDSN---------------------------- 52
            ::||.    |||:| |..:.|..::|. .|.|::|..                            
  Rat   357 ESPLG----LRQILSQSTDSLNMRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAV 417

  Fly    53 NSSPIGSPNPDAGKRLGFRRQAIQEIISSEKSYLEQLELLMNFF---------VRPLKEQAIIDC 108
            :||.:.....:..|    ::..|.|:|.:|..::..|:::...|         :.|...|.:..|
  Rat   418 DSSFLQQHKKEVMK----KQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPC 478

  Fly   109 SN-----HTLLFGQI---------------EMIHNLNGEFLRELE-ANMENVAHAFLKMAPFFKL 152
            .:     ||....|:               .:||.|....:.:.. :|.|.:.          |.
  Rat   479 VDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMR----------KT 533

  Fly   153 YSVYAFDYRGALFIIQDLISKNPVFRKFL-EQTESRPEVQRKLNSLMIVPIQRVPRYKLLLEQVL 216
            ||.:...:..||.:.::|.:::..|::|: :.|.|....:..:...:::..||:.:|.:|:.::|
  Rat   534 YSEFCSRHTKALKLYKELYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRIL 598

  Fly   217 LYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPS------- 274
            ..:...:.:|:.|..::..::...|:::..|.|.|....|..:.|.:..|....|...       
  Rat   599 QNSHGIEEEYQDLAAALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDE 663

  Fly   275 ---RRVIKEGVLQKITHKGTEIKRYCVLMSDIFMYCKMIKERAPNTVVENSLECCCIFPLKKCKV 336
               |::|.:|.|...|..|.......:||:|:.::   ::|: ....:..||:...:..|:...|
  Rat   664 LLRRKLIHDGCLLWKTATGRFKDVLLLLMTDVLVF---LQEK-DQKYIFTSLDKPSVVSLQNLIV 724

  Fly   337 YEMLPGNFKLTCQSDGI-IFGSGDVQL------SR----TWVGFIRDAIDL 376
            .:       :..|:.|: :..||..::      ||    ||:..|:.::.|
  Rat   725 RD-------IANQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRL 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 35/200 (18%)
PH-like 269..>311 CDD:302622 10/51 (20%)
PH 277..374 CDD:278594 22/107 (21%)
Arhgef2XP_006232705.1 C1_ARHGEF2 230..290 CDD:410427
RhoGEF 432..626 CDD:238091 35/203 (17%)
PH_ARHGEF2 666..781 CDD:275428 24/114 (21%)
SMC_prok_B <898..>1057 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.