DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Arhgef26

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_227201.4 Gene:Arhgef26 / 310460 RGDID:1562559 Length:869 Species:Rattus norvegicus


Alignment Length:319 Identity:81/319 - (25%)
Similarity:135/319 - (42%) Gaps:54/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QERNLLTAKSRRKVCSMLDSNNSSPIGSPNPDAGKRLGF----------RRQAIQEIISSEKSYL 86
            :|:.::..|..|...|.|             .|.||.|.          |::||.|:||||.|||
  Rat   402 EEKIVIHHKPLRSTWSQL-------------SAVKRNGLSQTVSQEERKRQEAIFEVISSEHSYL 453

  Fly    87 EQLELLMNFFVRPLKEQAIIDCSNHT---LLFGQIEMIHNLNGEFLRELEANMEN---------- 138
            ..||:|:..| :..||  :.|....|   .||..|..:...:.:|..||||..:|          
  Rat   454 LSLEILIRMF-KDSKE--LTDTMTKTERHHLFSNITDVWEASKKFFTELEARHQNNIFIEDISDI 515

  Fly   139 -VAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQR-KLNSLMIVP 201
             ..|......|:.|..:...:..|    .:|.|::.||.|::.|.:.||..:.:. .:.|.:|:|
  Rat   516 VEKHTASTFDPYVKYCTNEVYQQR----TLQKLLTTNPSFKEVLSRIESHEDCRNLPMISFLILP 576

  Fly   202 IQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQ--YLIHLQNSLV 264
            :|||.|..||::.:...|......|::.|.::||:.......|....:.|.|:  |.|:.|....
  Rat   577 MQRVTRLPLLMDTICQKTPKDSPKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFK 641

  Fly   265 NRTPNIVKPSRRVIKEGVLQK-------ITHKGTEIKRYCVLMSDIFMYCKMIKERAPN 316
            .:...:|..||.::|.|.|..       .:.:.::.:.|..|.:|:.:..|...|.:.|
  Rat   642 IKPFPLVSSSRWLVKRGELTAYVEDTVLFSKRMSKQQVYFFLFNDVLIITKKKSEESYN 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 53/184 (29%)
PH-like 269..>311 CDD:302622 10/48 (21%)
PH 277..374 CDD:278594 9/47 (19%)
Arhgef26XP_227201.4 TDA11 140..>348 CDD:293689
RhoGEF 441..620 CDD:279015 53/185 (29%)
PH_ephexin 641..779 CDD:269929 12/60 (20%)
SH3_ARHGEF16_26 791..845 CDD:212871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.