DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and ARHGEF16

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_016856538.1 Gene:ARHGEF16 / 27237 HGNCID:15515 Length:726 Species:Homo sapiens


Alignment Length:434 Identity:108/434 - (24%)
Similarity:176/434 - (40%) Gaps:93/434 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RQKGYGNGFIHSPQTPLSFSRELRQVLQERNLLTAKSRRKVCSMLDSNNSSPIGSPNPDAG---- 65
            |::|:...|...||        |.|.:|||.|.|  |:.....:|| .:|||.|:...||.    
Human   218 RKRGHKGSFKDDPQ--------LYQEIQERGLNT--SQESDDDILD-ESSSPEGTQKVDATIVVK 271

  Fly    66 ---------------KRLGF----------RRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAI 105
                           ..||.          |::|:.||::||.||...|.:|:..|::..:.:|.
Human   272 SYRPAQVTWSQLPEVVELGILDQLSTEERKRQEAMFEILTSEFSYQHSLSILVEEFLQSKELRAT 336

  Fly   106 IDCSNHTLLFGQIEMIHNLNGEFLRELEAN------MENVA-----HAFLKMAPFFKLYSVYAFD 159
            :....|..||..|..:...:..|..:||..      :|:::     ||.....|:....|...:.
Human   337 VTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKHFHPYIAYCSNEVYQ 401

  Fly   160 YRGALFIIQDLISKNPVFRKFLEQTESRPEV-QRKLNSLMIVPIQRVPRYKLLLEQVLLYTSPAD 223
            .|    .:|.|||.|..||:.|.:.|.||.. ...:.|.:|:|:|||.|..||::.:.|.|....
Human   402 QR----TLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHS 462

  Fly   224 ADYKLLKESVKEIEATASHINTCVEEQEITQ--YLIH--LQNSLVNRTPNIVKPSRRVIKEGVL- 283
            ..||....::|.|.......|......|..:  |.:|  |..|.|...| ::..||.::|.|.| 
Human   463 ERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLP-LISASRWLLKRGELF 526

  Fly   284 --------QKITHKGTEIKRYCVLMSDIFMYCKMIKERAPNTVVENSLECCCIFPLKKCKVYEM- 339
                    :||..:.|   .|..|.:|:.:..|  |:...:.:|::..:...| .::|.:..|: 
Human   527 LVEETGLFRKIASRPT---CYLFLFNDVLVVTK--KKSEESYMVQDYAQMNHI-QVEKIEPSELP 585

  Fly   340 LPGN----------FKLTC--QSDG----IIFGSGDVQLSRTWV 367
            |||.          |::|.  .|:|    ::..|........|:
Human   586 LPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWI 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 50/181 (28%)
PH-like 269..>311 CDD:302622 12/50 (24%)
PH 277..374 CDD:278594 24/117 (21%)
ARHGEF16XP_016856538.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.