DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and ARHGEF26

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001238891.1 Gene:ARHGEF26 / 26084 HGNCID:24490 Length:871 Species:Homo sapiens


Alignment Length:324 Identity:79/324 - (24%)
Similarity:133/324 - (41%) Gaps:48/324 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SRELRQVLQERNLLTAKSRRKVCSMLDSNNSSPIGSPNPDAGKRLGF----------RRQAIQEI 78
            |....|...|:.::..|..|...|.|             .|.||.|.          |::||.|:
Human   396 SEPKEQKSDEKIVIHHKPLRSTWSQL-------------SAVKRKGLSQTVSQEERKRQEAIFEV 447

  Fly    79 ISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEANMEN----- 138
            ||||.|||..||:|:..|....:....:..:....||..|..:...:.:|..||||..:|     
Human   448 ISSEHSYLLSLEILIRMFKNSKELSDTMTKTERHHLFSNITDVCEASKKFFIELEARHQNNIFID 512

  Fly   139 ------VAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQR-KLNS 196
                  ..|......|:.|..:...:..|    .:|.|::.||.|::.|.:.||..:.:. .:.|
Human   513 DISDIVEKHTASTFDPYVKYCTNEVYQQR----TLQKLLATNPSFKEVLSRIESHEDCRNLPMIS 573

  Fly   197 LMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQ--YLIHL 259
            .:|:|:|||.|..||::.:...|......|::.|.::||:.......|....:.|.|:  |.|:.
Human   574 FLILPMQRVTRLPLLMDTICQKTPKDSPKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINS 638

  Fly   260 QNSLVNRTPNIVKPSRRVIKEGVLQK-------ITHKGTEIKRYCVLMSDIFMYCKMIKERAPN 316
            |.....:...:|..||.::|.|.|..       .:.:.::.:.|..|.:|:.:..|...|.:.|
Human   639 QLEFKIKPFPLVSSSRWLVKRGELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYN 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 49/181 (27%)
PH-like 269..>311 CDD:302622 10/48 (21%)
PH 277..374 CDD:278594 9/47 (19%)
ARHGEF26NP_001238891.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..233
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..310
RhoGEF 443..622 CDD:279015 49/182 (27%)
PH_ephexin 643..781 CDD:269929 12/60 (20%)
SH3_ARHGEF16_26 793..847 CDD:212871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.