DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and rgf1

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_588116.1 Gene:rgf1 / 2539580 PomBaseID:SPCC645.07 Length:1334 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:72/292 - (24%)
Similarity:128/292 - (43%) Gaps:54/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RRQAIQEIISSEKSYLEQLELLMNFFVRPL----------KEQAIIDCSNHTLLFGQIEMIHNLN 125
            |::.|.|:|.:|:.:::.||.|.:::::||          ||:.|     .|:....:| :..:|
pombe   622 RQEVICEVIYTERDFVKDLEYLRDYWIKPLWASSCIPERKKEKFI-----RTVFLNALE-VQAVN 680

  Fly   126 GEFLRELEAN------MENVAHAFLKMAPFF---------KLYSVYAFDYRGALFIIQDLISKNP 175
            .:....|...      ::|:|..||:..|.|         :||..|.|:...         |.||
pombe   681 SKLAEALTKRQNYKPIVDNIADIFLEHVPKFEPFIRYGAGQLYGKYEFEKEK---------SSNP 736

  Fly   176 VFRKFLEQTESRPEVQR-KLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEAT 239
            .|.||:...|...|.:: :||..:..|..|:.||.||||.||.||...:.|.:.:.:.:..:...
pombe   737 AFAKFVSDVERLKESRKLELNGYLTKPTTRLARYPLLLEAVLKYTDEGNPDKQDIPKVINIVRGF 801

  Fly   240 ASHINTCVEEQEITQYLIHLQNSLVNRTP-----NIVKPSRRVIKEGVLQKITHKGTEIKRYCVL 299
            .|.:|....:.|....|.||...||.:..     :::..:|::|.:|.|:|.:...|..:.    
pombe   802 LSRLNVESGKAENKFNLFHLNQQLVFKPGEHYDLHLLDANRQLIFKGPLKKRSAGSTSSES---- 862

  Fly   300 MSDI--FMYCKMIKERAPNTVVENSLECCCIF 329
            .||:  |::...:....|.|:  |..|...:|
pombe   863 ASDVTLFLFDHALLIVKPKTI--NKRELLKVF 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 50/195 (26%)
PH-like 269..>311 CDD:302622 9/43 (21%)
PH 277..374 CDD:278594 13/55 (24%)
rgf1NP_588116.1 ROM1 6..1320 CDD:227709 72/292 (25%)
DEP_fRom2 416..497 CDD:239882
RhoGEF 625..806 CDD:279015 50/195 (26%)
PH_5 844..972 CDD:292048 13/55 (24%)
CNH 1004..1290 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I2911
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47379
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.