DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and rgf3

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_588115.1 Gene:rgf3 / 2539437 PomBaseID:SPCC645.06c Length:1275 Species:Schizosaccharomyces pombe


Alignment Length:300 Identity:70/300 - (23%)
Similarity:124/300 - (41%) Gaps:50/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NSSPIGSPNPDAGKRLGFRRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQ--AIIDCSNHTL-- 113
            |.|.:.|......||...|:..|.|:|..|..|:..|..|...|...:.:|  ||:. ||...  
pombe   448 NISSLNSLPSSLSKREIARQNNIHELICKESDYVADLNTLAELFRDGIVQQQDAIVP-SNRVADF 511

  Fly   114 ---LFGQIEMIHNLNGE------FLRE-LEANMENV--------AHA----FLKMAPFFKLY-SV 155
               :||.:|.|..|:..      .:|| |:..:.::        .||    ::..|..|.|. ..
pombe   512 IQSVFGNVESIRQLHSRLFLPQLIMRERLQGPVVSIIGDILLEWIHAAKSSYINYAKQFPLADET 576

  Fly   156 YAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQR-KLNSLMIVPIQRVPRYKLLLEQVLLYT 219
            |..:           ..:|..|.::|....|.|..:| .....:..|.||:.||.|.|:.:|.:|
pombe   577 YKLE-----------CQRNTYFARWLAACRSDPRCRRLDFQHFLQRPTQRLQRYTLELDTILKHT 630

  Fly   220 SPADADYKLLKESVKEIEATASH----INTCVEE---QEITQYLIHLQNSLVNRTPNIVKPSRRV 277
            ..:..|::|:.::|||:.||...    |.|.:|.   ::::..|:...:..||.  .:..|.|..
pombe   631 EQSSWDFQLITQAVKELRATCEECDAVIATVLEANRIRDLSYQLLFKNHESVNL--ELRDPEREF 693

  Fly   278 IKEGVLQKITHKGTE-IKRYCVLMSDIFMYCKMIKERAPN 316
            ..||::|:.:....: :..:..|:.:..:..|..|::..|
pombe   694 FFEGIVQRRSDSRLDWLDIHLFLLDNYLIMAKARKDKRTN 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 49/201 (24%)
PH-like 269..>311 CDD:302622 7/42 (17%)
PH 277..374 CDD:278594 6/40 (15%)
rgf3NP_588115.1 RhoGEF 470..656 CDD:279015 49/197 (25%)
PH-like 695..850 CDD:302622 6/38 (16%)
CNH 939..1236 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47379
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.