DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Ngef

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_038938943.1 Gene:Ngef / 246217 RGDID:1309055 Length:700 Species:Rattus norvegicus


Alignment Length:416 Identity:92/416 - (22%)
Similarity:173/416 - (41%) Gaps:80/416 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEANM 136
            ::|:.|:::||.||.:.|.||::.|:...:.:.|:..|...:||..:..:..::..||.|||..|
  Rat   265 QEAMFELVTSEASYYKSLNLLVSHFMENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRM 329

  Fly   137 -ENVAHA------FLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQ-RK 193
             ||:..:      :...|..|.:|..|..:........:.|:.:...||:.:.|.|..|:.: ..
  Rat   330 EENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKTAFRELIAQLELDPKCKGLP 394

  Fly   194 LNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQYLIH 258
            |:|.:|:|.||:.|.|||::.:|..............::.||:|......|..|.:...|:.:|.
  Rat   395 LSSFLILPFQRITRLKLLVQNILKRVEEGSEREGTALDAHKELEMVVKACNEGVRKMSRTEQMIS 459

  Fly   259 LQNSL---VNRTPNIVKPSRRVIKEGVLQKI----THKGTEIKR-----YCVLMSDIFMYCKMIK 311
            :|..:   :...| |:..||.::|:|.||::    |.:....|:     |..|.:|:.:.|:.| 
  Rat   460 IQKKMEFKIKSVP-IISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQI- 522

  Fly   312 ERAPNTVVENSLECCCIFPLKKCKVYEMLP-GNFKLTCQSDGIIFGSGDVQLSRTWVGFIRDAID 375
                              |..|.:|::..| |..::....|     .|....:...:..:.:|.|
  Rat   523 ------------------PGDKYQVFDSAPRGLLRVEELED-----QGQTLANVFILRLLENADD 564

  Fly   376 LHVQCRKTLRKDSSKRTPIRKKDMKKFGADYVLSPNKR----------------KCEYDTVFRNK 424
            ...   ..:.|.||      :.:||::...  |:||:|                :|.:..|.:..
  Rat   565 REA---TYMLKASS------QSEMKRWMTS--LAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQP 618

  Fly   425 NRST-------DSEEETEDSACFSRK 443
            :..|       :..|:|||...|..:
  Rat   619 DELTLELADILNILEKTEDGWIFGER 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 46/177 (26%)
PH-like 269..>311 CDD:302622 13/50 (26%)
PH 277..374 CDD:278594 18/106 (17%)
NgefXP_038938943.1 RhoGEF 267..445 CDD:395496 46/177 (26%)
PH_ephexin 467..593 CDD:269929 33/161 (20%)
SH3_ephexin1 606..660 CDD:212872 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.