DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Fgd4

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_038943909.1 Gene:Fgd4 / 246174 RGDID:708357 Length:887 Species:Rattus norvegicus


Alignment Length:466 Identity:109/466 - (23%)
Similarity:192/466 - (41%) Gaps:106/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EIISSEKSYLEQLELLMNFFVRPLKEQA---IIDCSNHTLLFGQIEMIHNLNGEF-LRELEANME 137
            |::.:|::|:.:|.||...|...|.|:|   .........:|..|..|:..:.:| |.|||..|:
  Rat   334 ELLLTERAYVSRLNLLDQVFYCKLLEEANRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKRMQ 398

  Fly   138 ------NVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQRK--- 193
                  .:.....|:|||.|:|..|...:..|:.:::::..:.|.|:...|      |:|::   
  Rat   399 EWETTPRIGDILQKLAPFLKMYGEYVKGFDNAVELVKNMTERVPQFKSVTE------EIQKQKIC 457

  Fly   194 ----LNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQ 254
                |...|:.||||:|||::||:..|...||...|:...|:|::.|...|||.|:.:.:.|..:
  Rat   458 GSLTLQHHMLEPIQRIPRYEMLLKDYLKKLSPDAPDWNDAKKSLEIISTAASHSNSAIRKMENLK 522

  Fly   255 YLIHLQNSLVNRTPNIVKPSRRVIKEGVLQKITHKGTEI-KRYCVLMSDIFMYCKMIKERAPN-T 317
            .|:.:. .::....:||.||..:||||.:.|:..:.|.. :||..|.:::.:||      .|. :
  Rat   523 KLLEIY-EMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYC------VPRFS 580

  Fly   318 VVENSLECCCIFPLKKCKVYEM----LPGNFKLTCQSDGIIFGSGDVQLSRTWVGFIRDAIDLHV 378
            :|.:.........:...|:.|.    .|..|:::.:...:...:...|....|:..::::||...
  Rat   581 LVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQVSGKERTLELQASSEQDKEEWIKALQESIDAFH 645

  Fly   379 QCRKTLRK---------------DSSKRTP--IRKKDM-------KKFGA--------------- 404
            |..:|.|.               :..||.|  ||..::       :.|.|               
  Rat   646 QRHETFRNAIAKENDIPLEVSTAELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCRACGHVV 710

  Fly   405 -----DYVLSPNKRKCEYDTVFRNK---------NRSTDSEEETEDSACFSRKRKVASGILRAPN 455
                 ||     |.:.|||....||         :...:|||         :||:   |||...:
  Rat   711 CWKCSDY-----KAQLEYDGGRLNKVCKDCYQIMSGFAESEE---------KKRR---GILEIES 758

  Fly   456 GNPMGKASSSS 466
            ....|.:...|
  Rat   759 AEVSGNSEVCS 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 53/183 (29%)
PH-like 269..>311 CDD:302622 15/42 (36%)
PH 277..374 CDD:278594 19/102 (19%)
Fgd4XP_038943909.1 RhoGEF 328..512 CDD:238091 53/183 (29%)
PH1_FDG4 544..637 CDD:275434 19/98 (19%)
FYVE_FGD1_2_4 675..739 CDD:277280 13/68 (19%)
PH2_FGD1-4 758..860 CDD:270056 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X316
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.