DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and ARHGEF12

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_056128.1 Gene:ARHGEF12 / 23365 HGNCID:14193 Length:1544 Species:Homo sapiens


Alignment Length:284 Identity:63/284 - (22%)
Similarity:120/284 - (42%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLN---------- 125
            |::.|.|:..:|::::..|::|...|.:.:..:.|:..|....:|..:|.|..|:          
Human   788 RQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAV 852

  Fly   126 ------------GE-----FLRELEANMENVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISK 173
                        ||     |....|..:::.|..|....||             ||.:|:....|
Human   853 RKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPF-------------ALEMIKSRQKK 904

  Fly   174 NPVFRKFLEQTESRPEVQR-KLNSLMIVPIQRVPRYKLLLEQVLLYTS-PADADYKLLKESVKEI 236
            :..|:.|::..||.|..:| :|..::...:||:.:|.|||:.:..||. |.:.:  .:|::....
Human   905 DSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTERE--KVKKAADHC 967

  Fly   237 EATASHINTCVEEQEITQYLIHLQNSL------VNRTPNIVK------PSRRVIKEGVLQKITHK 289
            ....:::|..|:|.|..|.|...|..|      ::..||:.:      ..|::|.||.|....::
Human   968 RQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNR 1032

  Fly   290 GTEIKRYCVLMSDIFMYCKMIKER 313
            ...|..|.:|:.||.:..:...:|
Human  1033 DKTIDLYTLLLEDILVLLQKQDDR 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 41/198 (21%)
PH-like 269..>311 CDD:302622 11/47 (23%)
PH 277..374 CDD:278594 10/37 (27%)
ARHGEF12NP_056128.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
PDZ_signaling 71..145 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..346
RGS_LARG 349..570 CDD:188708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..706
RhoGEF 791..976 CDD:279015 41/199 (21%)
PH_LARG 995..1132 CDD:275425 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1138..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.